KEGG   Paenibacillus graminis: PGRAT_22825Help
Entry
PGRAT_22825       CDS       T03325                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
pgm  Paenibacillus graminis
Pathway
pgm00620  Pyruvate metabolism
pgm00630  Glyoxylate and dicarboxylate metabolism
pgm01100  Metabolic pathways
pgm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pgm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PGRAT_22825
   00630 Glyoxylate and dicarboxylate metabolism
    PGRAT_22825
Enzymes [BR:pgm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     PGRAT_22825
    1.2.1.22  lactaldehyde dehydrogenase
     PGRAT_22825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487 FIST_C LuxC
Motif
Other DBs
NCBI-ProteinID: AIQ70167
UniProt: A0A089MA73
Position
complement(5051995..5053425)
Genome map
AA seq 476 aa AA seqDB search
MYIDGQFTESESKEWMDVTNPATDEVISQVPKAVRNDVVRAINAADEAQTAWEETPAVER
GKYLHAIADGIRAEADSLARLISEEVGKTLELSMVEVNFTADYMDYMAEWARRYEGEIVQ
SDRDNEHIFVFKRAIGVTTGILPWNFPFFLIARKMAPALITGNTIVVKPSAESPNNAVAF
AKIVDKSGLPKGVFNLVTGKGGEVGNELASNPKVGMVSLTGSVPAGQKVMEAAAENIIKV
SLELGGKAPAIVMGDADLDLAVKAIVDSRVINTGQVCNCAERVYVHETIKDEFTSRLVEA
MKAVKYGDPLKDTDIQMGPLINKAAQESVQKKVDRAVQEGATIALGGKKVEGAGSFFEPT
VITGATNEMEIVQEEIFGPVIPVISFANLDEAIALANDSEFGLTSSLYTRNLNVAMKVIK
RLKYGETYINRENFEAMQGFHAGWRKSGIGGADGKHGLNEYLQTHVVYLQYDKSVN
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtatatcgacggccagtttaccgaatcagaaagcaaagagtggatggatgtaaccaat
ccggcaacagatgaagtcatttcacaggtccccaaagctgtaaggaatgacgtggtgcgt
gccatcaacgcagcggatgaggcccagactgcctgggaagaaacacctgcggttgagaga
gggaagtatcttcatgccattgccgatggaatccgggcggaggcggacagcctggccaga
ctgatctccgaagaggtaggcaagaccttggaactgtccatggtcgaggttaactttaca
gcggactatatggactatatggcagaatgggcccgccgctatgaaggtgagattgtacag
agtgaccgggataatgagcatatttttgtgtttaaacgggcgataggggtcactaccggc
atacttccttggaatttcccgttctttttgattgccagaaaaatggccccggcgctgatc
accggaaatacaattgtagtcaagcctagtgccgaatctccaaacaatgcagtggccttt
gccaaaattgttgacaaatccggtctccccaaaggggtgttcaacctggttacgggaaaa
ggcggagaggttggcaatgaactggccagcaaccctaaagtcgggatggtgagtctaacc
ggcagcgtgccggcaggacaaaaggtgatggaggccgctgccgaaaatatcatcaaggtc
agtctggagcttggcggcaaggcgccagccattgtgatgggtgacgccgatctggacttg
gctgtcaaagcgattgtggattcccgggtgattaatacagggcaggtctgcaactgtgcg
gagcgggtctatgtgcatgagaccatcaaggacgaattcaccagccgtctggttgaggca
atgaaagcggtgaagtatggcgatccgctaaaagacacggatattcagatggggccgctg
attaacaaggccgcccaagaatcggtgcagaaaaaggttgaccgcgcagtacaagagggg
gctacaatcgcccttggcggtaaaaaagtggagggtgcaggcagtttttttgagccgacg
gttattacgggtgccaccaatgagatggagatcgtccaagaggaaatcttcgggccggtc
atcccggtcatttcattcgccaacctggatgaagcgatcgcgcttgccaatgacagtgaa
tttggactgacctcttcactatatacccggaatctgaacgtcgccatgaaagtcatcaag
cggctcaaatacggggaaacctatattaaccgcgagaactttgaagcgatgcagggcttc
catgcaggctggagaaaatcaggcatcggcggcgcggacggcaaacacggcttgaacgaa
tatctgcagacccatgtggtttatttgcagtatgataaatcagtcaactga

DBGET integrated database retrieval system