KEGG   Paenibacillus graminis: PGRAT_24445Help
Entry
PGRAT_24445       CDS       T03325                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
pgm  Paenibacillus graminis
Brite
KEGG Orthology (KO) [BR:pgm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pgm03009]
    PGRAT_24445
Enzymes [BR:pgm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     PGRAT_24445
Ribosome biogenesis [BR:pgm03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    PGRAT_24445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 Ub-Mut7C ECR1_N
Motif
Other DBs
NCBI-ProteinID: AIQ70421
UniProt: A0A089M9F9
Position
complement(5386627..5387601)
Genome map
AA seq 324 aa AA seqDB search
MNELNKDVNQQVPSGAAEEERDVTEWTVAGENARERIDKYITESWEDEISRSQVQLWISG
GHVTVNGAPVKANYKLAEGDLVAVTVPEAEVTDLIAEDIPLEVVYEDSDVIVVNKPRGMV
VHPAAGHPSGTLVNALMYHCKDLSGINGEIRPGIVHRIDKDTSGLIMAAKNDASHASLAA
QLKEHSVTRRYIAVVHGNLSHDQGTVDAPIGRDPHDRKLYTVTEKNSKRSVTHFTVLERF
GDCTLLELQLETGRTHQIRVHMKFIGHPLVGDPIYGRSKGTTMNGQALHAAVLGFVHPST
GEYMEYSAPIPADMEEVLFALRSR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagttgaataaggacgtcaatcagcaggtgccctccggtgccgcggaagaagaa
agggacgtcacggaatggactgttgccggggagaatgcccgggagcggatcgataaatac
attacggagtcttgggaagatgagatttcacgctcccaggtacagctgtggatcagcgga
ggtcatgtaaccgtaaatggcgctccggtgaaagccaactataaactggccgaaggcgat
ttggttgcagttactgtaccggaagctgaggtgacagacctgattgcggaggatattccg
ctcgaagtggtctatgaggacagcgatgttattgttgtaaataaaccgcgtgggatggtg
gttcatccggcagccgggcatccctccggcacactggtcaatgcgctgatgtatcattgc
aaggacctgtccggcattaacggcgagattcgtccggggattgtgcaccgtatcgataaa
gacacctctggactgattatggccgccaaaaatgacgccagccatgcttcgctcgcagcc
cagctcaaagagcatagtgtaacccgccgctacatcgctgtagtacacggtaatctgtcc
catgaccaaggtacggtagatgcgcctattggccgtgatccgcatgaccgcaagctctat
accgtaaccgaaaagaacagcaaacggtctgtgacccattttaccgtgctggaacgtttt
ggggattgcactctgctggagctgcagcttgagaccggacgcacgcaccagattcgtgtg
catatgaagtttatcggtcatccgctggtcggagatcccatctacgggcgcagcaaaggg
acgactatgaacggacaggctctgcatgccgctgtgctgggatttgtgcatccctccacc
ggtgaatatatggagtatagtgcgcccattccggccgatatggaagaagtgctgtttgct
ctgcggagcagataa

DBGET integrated database retrieval system