KEGG   Porphyromonas gingivalis ATCC 33277: PGN_0204Help
Entry
PGN_0204          CDS       T00714                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
pgn  Porphyromonas gingivalis ATCC 33277
Pathway
pgn00860  Porphyrin and chlorophyll metabolism
pgn01100  Metabolic pathways
pgn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pgn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PGN_0204
Enzymes [BR:pgn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     PGN_0204
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     PGN_0204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_3 FAD_binding_2 Pyr_redox FAD_binding_3 Pyr_redox_2 HI0933_like ApbA FAD_oxidored Thi4 MCRA
Motif
Other DBs
NCBI-ProteinID: BAG32723
UniProt: B2RH78
Position
216781..218178
Genome map
AA seq 465 aa AA seqDB search
MDHLTVIIGAGLTGLTTAAFLRAAGRPVLVLERAAHIGGQIRTYRENGFVFETGPNTGTI
SSPEVAELFELLGLEPEIATPAASNRLIWKGNKLYPLPRNIAEAVATPLFSLWDKWRILG
EPFRRRGGQPNETVGALARRRLGKSFVDYAVDPFLGGIYAGDADQLVTRFALPKLYDLEQ
RYGSFVLGAVRKARQPQNERDRKASRKVFSVQGGLGLLVEALADYIGREHILTETQIRYI
NHPGAHTFGLTYTDASEEEHTIPCRHLVSTVAAHHIPTLFDRFPADESAVFEQLYYAPMI
EVAVGFRRNVATHLPAFGCLIPSRENRRILGILFPSDCFRGRAPEGGALYSIFMGGVRNA
SLIDLSDEEISTIAMEELRDMLHIPHTCKPDLLHISRHRHAIPQYYADTELRQDIIRRME
MRWPGLHLGGNMHGGIGMAHRISQGVEMARSIIEETAIAERSARG
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggatcatctgaccgtcatcataggagccgggctcaccggactgaccacagccgctttc
ctcagagctgccggcaggcctgttctggttttggagcgagctgctcatatcggcggacag
atacgcacctacagagagaacgggttcgtgttcgagacagggccgaataccggcacgatc
tcctctccggaagtagccgagctattcgaactgctcggattggaacctgagatagccact
cctgcggcctctaaccgtctgatatggaaaggcaacaaactgtatccccttccaaggaac
atcgccgaggcagtcgctactcctctcttttccctgtgggacaaatggcgtatcctcggc
gaacccttccgccggagaggcggacaacccaatgagacggtcggagccttggctcgtcgc
cggctgggcaaaagttttgtggactacgcagtcgatcctttcctcggaggtatttatgca
ggagatgccgaccaactggttactcgctttgccctgcccaaactatacgatctggagcag
cgatacggcagcttcgtactgggtgccgttcgaaaagcccgacagccacaaaacgaacgc
gaccgcaaagcctcgcgcaaggtcttttccgtacaagggggactcggtcttctggtcgaa
gctttggctgactatatcggacgcgaacacatcctgacggaaacgcaaatccgatacatc
aatcacccgggagcacacaccttcggccttacctatacggatgcttcggaagaggagcac
accattccttgccgccacttggtgagtacggtggcagcgcaccatatccccacactgttc
gaccgcttccctgcggatgaatcagccgtgttcgagcagctctattatgcacccatgata
gaggttgccgtagggttccgccggaatgttgccacacacctgccggctttcggttgcctg
atcccttcgagggaaaatcgtcgcatcctcggcatcctgttcccttcggactgtttccgt
ggcagagcacctgaagggggcgcactctattccatattcatgggtggggtgcgaaatgct
tcgctcatagacctttccgacgaggagatcagcacgattgcaatggaagagctgcgcgat
atgctgcacatacctcacacctgtaagccggatctgctgcacatctcacgccaccgccat
gccataccgcagtactacgccgatacggaacttcggcaagacatcatccggcggatggaa
atgcgctggccgggcttgcatttgggtggcaatatgcatgggggaataggtatggcacat
cgtatctcacaaggtgtggaaatggctcgaagtatcatagaagagacagccatcgccgaa
cgctctgccagaggctga

DBGET integrated database retrieval system