KEGG   Porphyromonas gingivalis ATCC 33277: PGN_0380Help
Entry
PGN_0380          CDS       T00714                                 

Definition
(GenBank) partial ROK family transcriptional repressor with glucose kinase domain
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pgn  Porphyromonas gingivalis ATCC 33277
Pathway
pgn00010  Glycolysis / Gluconeogenesis
pgn00052  Galactose metabolism
pgn00500  Starch and sucrose metabolism
pgn00520  Amino sugar and nucleotide sugar metabolism
pgn00521  Streptomycin biosynthesis
pgn01100  Metabolic pathways
pgn01110  Biosynthesis of secondary metabolites
pgn01120  Microbial metabolism in diverse environments
pgn01130  Biosynthesis of antibiotics
pgn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pgn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PGN_0380
   00052 Galactose metabolism
    PGN_0380
   00500 Starch and sucrose metabolism
    PGN_0380
   00520 Amino sugar and nucleotide sugar metabolism
    PGN_0380
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PGN_0380
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PGN_0380
Enzymes [BR:pgn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PGN_0380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG FGGY_N RuvC DUF460 Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: BAG32899
UniProt: B2RHQ4
Position
414732..415511
Genome map
AA seq 259 aa AA seqDB search
MEKPYVLGVDVGGTNTVFGVVDARGNLVISSSIKTGAHNDLNDYIKDLTAGINQLIEQVG
GKEKIKGIGVGAPNGNYYTGSIEFAPNLPWKQTKIPFAQMLTDSLGIPTTLTNDANAAAI
GEMTYGAARGMKDFIVITLGTGVGSGIVVNGSLVYGHDGFAGELGHMIVRRNGRMCGCGR
QGCLETYTSATGVARTAREYLDIRSDKSLLRNIQPDLIREFDIKKWHNTLVISVFYFPHS
VFQALILLSDGFLSTSETQ
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagccttatgtattaggagtggatgtaggcggtaccaacaccgtattcggagtg
gtggacgctcgtggcaatttggttataagttcgtccatcaagaccggagcgcacaacgat
ctgaacgattatatcaaagatctgactgccggcatcaatcagttgatcgaacaggtagga
gggaaagagaagataaagggtatcggtgtaggtgctcccaatggaaactattataccgga
tcgatcgagtttgcgcccaatttgccttggaaacagaccaaaatacccttcgcccaaatg
ctcaccgattcattaggtatccccacgacactgaccaatgatgccaatgctgctgccatc
ggggagatgacctatggagcagctcgtggcatgaaggacttcatcgttatcacgctcggt
acgggggtcggaagcggcatagtagtcaatggcagcttggtgtacggacacgatggattt
gccggtgagctgggacacatgatcgttcgccgcaatggtcgcatgtgcggttgtggcaga
cagggctgtctcgagacttacacctctgctacaggagtagcccgtacagctcgtgaatat
ctggacatccgttcggacaagagcttgctccggaacattcagcccgatctgatacgtgag
ttcgatataaagaaatggcacaacacattggttattagtgtgttttattttccacacagt
gtttttcaggcacttatattgctttcagatggctttttatctacatctgaaacccaatga

DBGET integrated database retrieval system