KEGG   Porphyromonas gingivalis ATCC 33277: PGN_0667Help
Entry
PGN_0667          CDS       T00714                                 

Definition
(GenBank) putative GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
pgn  Porphyromonas gingivalis ATCC 33277
Pathway
pgn00790  Folate biosynthesis
pgn01100  Metabolic pathways
Module
pgn_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pgn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PGN_0667
Enzymes [BR:pgn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PGN_0667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI DUF3638 QueF
Motif
Other DBs
NCBI-ProteinID: BAG33186
UniProt: B2RIJ1
Position
726457..727038
Genome map
AA seq 193 aa AA seqDB search
MTEIEKEEACSRLQQHYAQVLSLLGEDPKREGLLKTPLRVAKAMQFLTKGYNEDPEAILR
AAMFEEDYQQMVIVKDIDFFSMCEHHMLPFFGKAHVGYIPNRYITGLSKLPRVVDVFARR
LQVQERLTTQIKECIQNTLNPLGVIVVIEAQHMCMQMRGVEKQNSLTTTSDFTGAFEEST
TREEFLNLIGRRR
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaatagaaaaagaagaagcctgcagccgcttgcaacagcattacgcccaagta
ctgtcgttgctcggcgaagaccctaagcgtgaagggctgctcaaaactccgctacgtgtg
gctaaggccatgcagtttctgaccaaaggatataacgaggatcctgaagccatccttcgc
gcagcgatgttcgaagaagactatcagcaaatggtcatcgtcaaggacatcgatttcttt
tcgatgtgtgagcaccacatgttgccgttcttcggtaaggcccatgtgggctatatcccc
aatcggtatataaccggactgagcaagttgccccgagtggtcgatgtatttgcccgtcgt
cttcaggtacaggaacggctgactacacaaatcaaggagtgcatccagaatacgctgaac
cctctcggggtgatcgtcgttatcgaagcacagcacatgtgcatgcagatgcgtggagtg
gagaagcaaaactctctgactacgaccagtgactttacaggagcttttgaggaatcgacc
actcgcgaagagtttctcaatctgatcggtcgcaggcgataa

DBGET integrated database retrieval system