KEGG   Porphyromonas gingivalis ATCC 33277: PGN_1375
Entry
PGN_1375          CDS       T00714                                 
Name
(GenBank) putative beta-ketoacyl-acyl carrier protein reductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
pgn  Porphyromonas gingivalis ATCC 33277
Pathway
pgn00061  Fatty acid biosynthesis
pgn00780  Biotin metabolism
pgn01100  Metabolic pathways
pgn01110  Biosynthesis of secondary metabolites
pgn01212  Fatty acid metabolism
pgn01240  Biosynthesis of cofactors
Module
pgn_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pgn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PGN_1375
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PGN_1375
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    PGN_1375
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pgn01004]
    PGN_1375
Enzymes [BR:pgn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     PGN_1375
Lipid biosynthesis proteins [BR:pgn01004]
 Fatty acid synthase
  Component type
   PGN_1375
SSDB
Motif
Pfam: adh_short_C2 adh_short KR
Other DBs
NCBI-ProteinID: BAG33894
UniProt: B2RKJ9
Position
complement(1528408..1529154)
AA seq 248 aa
MKLLENKVALITGAGRGIGRAIAYKYATEGADVAITDLNIDEGVQAFVEELKGLGVRAAA
YASNAADFDAAHTVVEQIKADFGRIDILVNNAGITRDGLMMRMTEQQWDAVINVNLKSAF
NMIHAVTPIMMGQRTGSIINMASVVGVSGNAGQSNYSASKAGMIGLAKSVAKELGSRGVR
ANAIAPGFIITDMTAVLSEEVKKQWAAQIPLRRGGTPEDVANVATFLGSDLSSYVTGQVV
HVCGGMNM
NT seq 747 nt   +upstreamnt  +downstreamnt
atgaaattattggagaacaaggtagctctcattacgggagccggacgcggtatcggccgt
gccatagcttataagtatgcaacggaaggtgccgatgtggctattactgatctgaatatc
gatgagggcgtacaggctttcgtagaagaactcaaagggctcggagtacgtgcagcggca
tacgcttccaatgcagcggacttcgatgctgcgcatacagtggtggaacagatcaaggct
gacttcggtcggatcgatattttggtgaacaatgccggcattactcgcgatggccttatg
atgcgtatgactgagcaacaatgggatgccgtgatcaacgttaatctgaagtcagcgttc
aacatgatccatgccgtgactcccatcatgatgggacagcgcaccggcagtatcatcaat
atggcttctgtggtaggtgtatcgggcaatgcaggacaatccaactactcagcttctaaa
gccggtatgatcggtttggccaagagtgtcgccaaagagctgggctcacgtggcgtgcgt
gccaatgcgattgcaccgggttttatcatcaccgatatgactgccgtacttagcgaagaa
gtgaagaagcaatgggcggcacagatacctctgcgtcgtggtggtacgcctgaagatgtg
gctaacgtagctaccttccttggcagtgacctctcttcgtacgtgacgggacaggtagtc
cacgtttgtggcggtatgaatatgtaa

DBGET integrated database retrieval system