KEGG   Porphyromonas gingivalis ATCC 33277: PGN_1460Help
Entry
PGN_1460          CDS       T00714                                 

Definition
(GenBank) putative guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
pgn  Porphyromonas gingivalis ATCC 33277
Pathway
pgn00230  Purine metabolism
pgn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgn00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PGN_1460
Enzymes [BR:pgn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PGN_1460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 AAA_22 AAA_16 NTPase_1 RsgA_GTPase Rad17 YtxH RNA_helicase
Motif
Other DBs
NCBI-ProteinID: BAG33979
UniProt: B2RKT4
Position
1636796..1637362
Genome map
AA seq 188 aa AA seqDB search
MTKLIIISAPSGTGKSTVIERLLTDRELNLHFSISATSRAPRGEEQNGREYYFLSPEEFR
RRIEANEFVEYEEVYRDKYYGTLKSEVERILKEEKNVIFDVDVVGAQSIKKYYGDRALAI
FILPPSIEELRSRLQKRGTDSMETIKQRVDKAEKEIGYAHLFDLRFVNDDLVTCVEQIRK
AIAQFLAK
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaactaatcatcatctcggccccatccggaacaggtaagagcaccgttatcgaa
cgacttcttacggacagagagcttaaccttcatttctctatttctgcaaccagccgtgca
cctcgtggagaagagcagaatggacgagagtattacttcttgtctccggaagaattcaga
cgaagaatagaggccaacgaattcgtagagtacgaagaggtgtacagagacaaatactat
ggcacgctcaaaagtgaggtagagcggatcctgaaagaagagaaaaatgtcattttcgac
gttgatgtcgttggagcacagagcatcaagaaatattatggagatagggcattggctatc
tttattttgcctccttctatagaagagctgcgttctcgtctgcaaaaacgaggtacggac
tctatggaaactattaagcagcgcgtggacaaggccgagaaagaaatcggttatgcacat
cttttcgacctgcgctttgtaaatgatgatttggttacttgtgtggaacagataaggaag
gcgattgcccaattcttagccaaataa

DBGET integrated database retrieval system