KEGG   Porphyromonas gingivalis ATCC 33277: PGN_1495Help
Entry
PGN_1495          CDS       T00714                                 

Definition
(GenBank) putative low-specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pgn  Porphyromonas gingivalis ATCC 33277
Pathway
pgn00260  Glycine, serine and threonine metabolism
pgn01100  Metabolic pathways
pgn01110  Biosynthesis of secondary metabolites
pgn01120  Microbial metabolism in diverse environments
pgn01130  Biosynthesis of antibiotics
pgn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pgn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PGN_1495
Enzymes [BR:pgn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     PGN_1495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: BAG34014
UniProt: B2RKW9
Position
1671373..1672407
Genome map
AA seq 344 aa AA seqDB search
MSKISFKNDYSEGAHPDILHALTDTNFVPQEGYGYDSYCEEVRAMIRRECNKPDAEVYFV
SGGTQTNLLVISHLLRPHEAVIAAQSGHINVHETGAIESTGHKVCTVPTPLGKLSVEHIR
EVLAFHTDEHMVRPSMVYISQSTELGTLYSRHELSDLSTFCRANDLLIYLDGARIGSAIM
AETEDNPTLTDIATLTDAFYIGGTKNGALLGEAIVFPRPRPDDAFLYQIKQRGAMLAKGR
VLGIQFATLFHDGLYYRLAAHANRMAADLATAISSCGYSFLYPPQTNQIFPILPNDLIER
LKAVFDFYVWQAVSSDSSAIRLVTSWATPSENVAAFAEYLSTHI
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagatcagcttcaaaaacgactactctgaaggtgcgcatcctgacatactgcat
gcgctgacagataccaacttcgttccacaagagggatacggctatgactcctattgcgag
gaagtgcgtgcgatgatccgccgtgaatgcaataagcccgatgccgaggtctatttcgta
tcgggtgggacgcagaccaatctcttggtgatcagtcacctgctccgtccgcacgaagct
gtcatagcagcacagtcagggcacatcaacgtacacgaaaccggtgccatcgaatccacc
ggacataaggtttgcacagtacctactccactcggcaaactcagtgtggagcatatccgc
gaagtccttgcttttcatacggacgaacacatggtaaggccgtccatggtctatatctcc
caatctacagagttgggcacactctattctcgtcatgaactgtcggatctgtccaccttt
tgccgtgcaaacgatctcctaatctacctcgacggtgcccgtatcggttcggcgatcatg
gcagagacagaggacaatccgaccctgaccgatatagccaccctgaccgatgcgttctac
atcggcggcaccaagaacggagcactccttggagaagccattgtcttccctcgtccacgt
ccggacgatgctttcctctatcaaatcaaacagcgtggagccatgttggccaaagggcgc
gtgctgggtatccagtttgccacgcttttccacgatgggctttactaccggcttgcagct
catgccaacagaatggcagcagatctggcgacggctatctcctcctgtggttattccttc
ctctaccctccgcaaaccaatcagatcttcccgatcctccccaacgatctgatcgaaaga
ctgaaagccgtattcgacttctacgtgtggcaagccgtatcatccgacagctctgctatt
cgtctggtcacgtcatgggctactccatcggagaatgtagccgcctttgccgaatatctt
tccacccacatatag

DBGET integrated database retrieval system