KEGG   Pseudobacter ginsenosidimutans: FSB84_26360Help
Entry
FSB84_26360       CDS       T06126                                 

Definition
(GenBank) aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pgo  Pseudobacter ginsenosidimutans
Pathway
pgo00260  Glycine, serine and threonine metabolism
pgo01100  Metabolic pathways
pgo01110  Biosynthesis of secondary metabolites
pgo01120  Microbial metabolism in diverse environments
pgo01130  Biosynthesis of antibiotics
pgo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pgo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FSB84_26360
Enzymes [BR:pgo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     FSB84_26360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1 Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: QEC45035
Position
6730479..6731507
Genome map
AA seq 342 aa AA seqDB search
MIDLRSDTFTLPTPGMLEAMMKAPVGDDVFGEDPSVNLLEQRMASLFNTEAALYCPTGTM
SNQIGIKAHTQPGDEVICEQSAHVYIYEGGGIAFNSGAQVRTLEGDHGRIRAEQVATAIN
PDDVHKARTSLVCLENTSNRGGGSCYDLEEIRRIREVCDQHRLLLHLDGARLFNALVAKQ
QAASDYGHLFNSISVCLNKGMGCPIGSVLMGSKDFIRRARRIRKVLGGGMRQAGYMAAAG
LYALDNHIGRLAEDHNHAQLIGAALMQTDYVESLLPVSTNIVIAKIKAPWKPAQITELLK
AKQILALPVSPTQIRMVLHLGITPEMAAITVDTIRNLKLDDL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacctccgttccgacaccttcaccttacctaccccgggcatgctggaagccatg
atgaaggccccggtgggcgacgatgtctttggtgaagacccatccgtaaacctcctggaa
caacgcatggccagtctctttaatacagaagcggcactttattgtccaactggcactatg
agtaaccagatcggtattaaagcgcatacacaaccgggtgatgaagtgatctgcgagcag
tccgcccatgtatacatttatgagggcggcggcattgctttcaattcaggggcgcaggtg
cgcacactggaaggcgaccatggaaggatcagggctgagcaggtggcaactgccatcaat
ccggatgatgtgcacaaggccagaaccagcctggtatgcctggaaaacacttccaatcgc
ggaggcggcagttgctacgatctggaagagatccggcgcatccgcgaggtttgcgatcag
caccggctcctcttgcacctcgatggcgccaggcttttcaatgcgctggtggcgaagcaa
caggctgccagtgattacggtcaccttttcaatagtatcagtgtttgtctcaataaaggg
atgggctgcccgataggcagtgtattgatgggcagtaaagattttatccgcagggcaaga
aggatcaggaaagtgttgggtggtggcatgcggcaggctggttatatggctgcagcagga
ctttatgcgctggacaatcatatcgggcgactggccgaagatcacaaccatgctcaattg
atcggagcagcattgatgcagacagattacgtggagagtcttttacccgtgagcaccaat
atcgtgatcgcaaaaatcaaagcgccctggaagccggcacagatcacggagctgctgaaa
gcaaaacagatcctcgcgttacctgtatctcctactcagatcaggatggtcctgcacctg
ggcattacgcctgaaatggccgctataacggtggatactatacgaaatttgaagttggat
gacctataa

DBGET integrated database retrieval system