KEGG   Paraburkholderia graminis: CUJ91_01240Help
Entry
CUJ91_01240       CDS       T05548                                 

Gene name
bioF
Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
pgp  Paraburkholderia graminis
Pathway
pgp00780  Biotin metabolism
pgp01100  Metabolic pathways
Module
pgp_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:pgp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CUJ91_01240 (bioF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pgp01007]
    CUJ91_01240 (bioF)
Enzymes [BR:pgp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     CUJ91_01240 (bioF)
Amino acid related enzymes [BR:pgp01007]
 Aminotransferase (transaminase)
  Class II
   CUJ91_01240 (bioF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AXF06669
UniProt: A0A2Z5LNX4
Position
PHS1_A:complement(283410..284594)
Genome map
AA seq 394 aa AA seqDB search
MHLLDKLSQGLKEIDEHGLRRRRRTVDTPCAAHMTVDGREIVGFASNDYLGLAAHPQLIA
AIAEGAQRYGAGSGGSHLLGGHSRAHAQLEDDLAEFVGGFVDAPRALYFSTGYMANLATL
TALAGRGTTLFSDALNHASLIDGARLSRADVQIYPHCDMEALSAMLDASDADEKVIVSDT
VFSMDGDIAPLPRLLELAERHGAWLIVDDAHGFGVLGPQGRGAIAEAALRSPNLISIGTL
GKAAGVSGAFVVAHGTVIEWLVQRARPYIFTTASVPAAAHAVSASLRIIGGDEGDERRAH
LRQLIERTRAMLKTTPWLPVDSHTAVQPLIIGANDATLEIAASLDRAGLWVPAIRPPTVP
AGTSRLRISLSAAHSHADLDRLEAGLQAAGEQSA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcatctgctcgacaaactttcgcagggactcaaggagatcgacgaacacggtctgcgc
cgtcgccgccgcaccgtcgacacgccgtgcgcggctcatatgacggtcgacggccgcgag
atcgtcggctttgcgagcaatgactatctcggactcgccgcgcatccgcagttgatcgcg
gccatcgcggaaggcgcacaacgctatggtgcgggcagcggcggttcgcatctgctcggc
ggccattcgcgcgcgcatgcgcagctcgaggacgatctcgcggagttcgtcggcggattc
gtcgatgcgccgcgcgcgctgtacttcagcaccggctacatggcgaatctcgcgacgctc
accgcgctcgcgggccgcggcacgacgctgttctccgatgcgctcaaccatgcttcgctg
atcgacggagcgcgtctgtcgcgagccgacgtgcagatctacccgcactgcgatatggaa
gcgctgagcgcgatgctcgacgcgtcggacgcggacgagaaggtcatcgtctccgatacg
gtgttcagcatggacggcgacatcgcgccgctgccgcgtcttctcgaacttgcggagcgg
cacggcgcgtggctgatcgtcgacgatgcgcacggtttcggcgtgctcggtccgcaaggc
cgcggcgcgatcgccgaagccgcgttgcgctcgccgaatctgatttccatcggcacgcta
ggcaaggcggcgggcgtgtcgggcgcattcgtcgtggcgcacgggaccgtgatcgagtgg
ctcgtgcaacgcgcgcgtccgtacattttcaccacggcttcggtgccggctgccgcgcac
gcggtgtcggcgagtctgcgcattatcggcggcgatgaaggcgatgagcggcgcgcgcat
cttcggcaattgatcgagcgcacgcgcgccatgctcaagaccacgccgtggcttcccgtc
gattcgcataccgccgtgcagccgctcattatcggcgcgaacgacgcgacgctcgagatt
gccgcgtcgctcgatcgcgcgggtttgtgggtgcccgcgattcggccgccgacagtgccg
gccggcacatcgcgcttgcgcatttcgctgtcggccgcgcattcgcatgcggatctcgac
cggctcgaagcgggcttgcaagccgcgggggagcaaagcgcatga

DBGET integrated database retrieval system