KEGG   Paraburkholderia graminis: CUJ91_03975Help
Entry
CUJ91_03975       CDS       T05548                                 

Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
pgp  Paraburkholderia graminis
Pathway
pgp00860  Porphyrin and chlorophyll metabolism
pgp01100  Metabolic pathways
Module
pgp_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:pgp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CUJ91_03975
Enzymes [BR:pgp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     CUJ91_03975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26
Motif
Other DBs
NCBI-ProteinID: AXF07163
Position
PHS1_A:901742..903286
Genome map
AA seq 514 aa AA seqDB search
MRFPTESNLPVSIHSIPHDAVFVPRGTLMIQGTTSDAGKSTLVAGLCRLARRAGVRVAPF
KPQNMALNSAVTVDGGEIGRAQALQAVAAGIAAHTDLNPVLLKPTSDRGAQVIIHGKARM
NLDARAYHDYKPVAFEAVLESYARLQAAYDTIFVEGAGSPAEINLRDRDIANMGFAEAVD
CPVVLVADIDRGGVFAHITGTLACLSASEQARVRGFIINRFRGDIGLLQPGLDWLEAKTS
KPVLGVLPYLHGLTLDAEDMLPPELRAAQRGDATRTLRVVVPVLPHISNHTDFDALRTHP
QVDFHYVRSGMAPPPADLIILPGSKNVPGDLAFLRAQGWDAVLERHLRYGGRVIGICGGM
QMLGREVADPHGVEGAPGTSAGLGWLDYSTVLTREKTLKNVSGRLALPGSPEVAGYEIHM
GETRGPALDSPALRLGQAGESRPDGALSVDGQILATYVHGLFDTPAACAALLAWAGLSDA
EAIDYPALREASLDRLADTLAEHLDLGKLMAAMA
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttccccaccgaatccaaccttcccgtgagcattcattcgatcccgcatgacgcc
gtcttcgtgccgcgcggcacgctgatgattcagggcaccacgtccgatgcgggcaagagc
acgctcgtcgccggcctatgccggctcgcgcggcgcgcgggcgtgcgcgtcgcgccgttc
aagccgcagaacatggcgctgaacagcgcggtgaccgtcgacggcggcgaaatcgggcgc
gcgcaggcgctgcaggcggtggccgccggcatcgccgcgcacaccgatctgaaccccgtt
ctgctcaagccgacgagcgatcgcggcgcgcaggtgatcatccacggcaaggcgcgcatg
aatctcgacgcccgcgcgtatcacgactacaagccggtcgccttcgaggcggtgctggag
tcgtatgcgcggctgcaagcggcgtacgacacgatcttcgtcgaaggcgcgggcagtccg
gccgagatcaatctgcgcgatcgcgacatcgccaacatgggttttgcggaagcggtcgac
tgtccggtcgtgctggtggcggacatcgaccggggcggggtgttcgcgcatatcacgggg
acgctcgcgtgcctgtcggcgagcgagcaggcgcgcgtgcgcggtttcatcatcaaccgt
tttcgcggcgatatcggactgctgcagccggggctcgactggctcgaagcaaagaccagc
aagccggtgctcggcgtgctcccgtatctgcacggcctcacgctcgacgccgaggacatg
ctgccgcccgagttgcgcgcggcgcagcgcggcgacgccacgcgcacgttgcgggtcgtc
gtgccggtgctgccgcatatcagcaatcacacggatttcgacgcgctgcgcacgcatccg
caggtcgattttcattacgtgcgaagcggcatggcgccgccgcccgccgatctgatcatt
ctgccgggttcgaagaacgtgcccggcgatctcgcgttcctgcgcgcgcaaggctgggac
gcggtgctcgagcggcatttgcgctacggcggccgggtgatcgggatctgcggcggcatg
cagatgctcgggcgcgaggtggcggacccgcatggcgtggagggcgcgccggggacgtcg
gcggggctgggctggctcgattactcgacggtgctgacgcgcgagaagacgctcaagaat
gttagcggccgcttggcgctgcctggttcgcccgaagtcgcgggctatgaaattcatatg
ggcgagacgcgcggtccggcgctcgactcgccggcgctgcgtctcgggcaagcgggcgag
tcgcgtcccgacggcgcgctgtccgtggatggccagattctcgcgacctacgtgcacggc
ctgttcgacacgccggccgcgtgcgcggcgctcctggcgtgggccggactgagcgatgcc
gaggcgatcgattatccggcgctgcgcgaagcgtcgctggatcggctggccgacacgctc
gcggagcacctggatctcgggaaattgatggcggcgatggcttga

DBGET integrated database retrieval system