KEGG   Paraburkholderia graminis: CUJ91_07370Help
Entry
CUJ91_07370       CDS       T05548                                 

Definition
(GenBank) zinc-binding dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pgp  Paraburkholderia graminis
Pathway
pgp00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pgp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CUJ91_07370
Enzymes [BR:pgp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     CUJ91_07370
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     CUJ91_07370
    1.1.1.-  
     CUJ91_07370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_assoc Glu_dehyd_C ADH_zinc_N_2 Pyr_redox_3 Shikimate_DH YdfZ
Motif
Other DBs
NCBI-ProteinID: AXF07768
UniProt: A0A2Z5LSZ1
Position
PHS1_A:complement(1665151..1666221)
Genome map
AA seq 356 aa AA seqDB search
MRAVRFHCAHDVRVENVPDPTGMGANQMIVKPLWCGICGTDLHEYQAGPIVVPTEPHALT
GAKAPQVLGHEFSAEVVEVGKDVKNVQRGDRISVMPLASCGQCYYCARGMRHLCSKMGCV
GLSWDGGGMAEYTLLNDYHANRLPDTVSDQQGALIEPAAVALYAVDRGGVTVGSTVLITG
AGPIGVLAALACHAAGATKIFVSEPNAARADKMAGFGVTTAIFDPSDGELPQKIRDLTEG
VGVDVAIECAGNQHALNACVDAVRSAGAVVQAGLHVGTASVDPMKWSLKDIRIEGTWCYP
VTIWPRIIGMIANGKFPVEKLIHDLIDADEVVEKGFDVLSDKGSDKMKILINPQTR
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagtgcgttttcactgtgcgcacgatgtccgggtcgaaaacgtaccggacccg
acgggcatgggcgcgaaccagatgatcgtcaagccgctgtggtgcggcatctgcggcacc
gatctgcacgagtatcaggcggggcccatcgtggtgccgaccgaaccgcatgcgctgaca
ggcgcgaaagcgcctcaggtgcttggccatgaattcagcgcggaggtcgtcgaagtcggc
aaggacgtgaagaacgtgcaacgcggcgaccgcatctcggtgatgccgctcgcgtcgtgc
ggacagtgctattactgcgcgcgcggcatgcgccatctgtgctcgaaaatgggctgcgtc
gggctcagttgggacggcggcggaatggccgaatacacgctgctcaacgactatcacgcg
aaccgcttgcccgacaccgtgagcgaccagcagggcgcgctgatcgaaccggccgctgtc
gcgctgtatgccgtcgaccgcggcggcgtcacggtcggctcgaccgtgctgattaccggc
gcaggcccgatcggcgtacttgccgccctcgcctgccatgcagcgggcgccacgaagatt
ttcgtgagcgaacccaatgcggcgcgagccgacaagatggccggcttcggcgtcacgacc
gcaatcttcgatccatccgacggcgaactgccgcaaaagattcgcgacctgacagaaggc
gtcggcgtggacgtggcgatcgaatgcgcgggcaaccagcatgcgctgaacgcatgcgtc
gacgcggtgcgatcggcgggcgctgtggttcaggcgggtctgcacgtgggcacagcgagc
gtcgacccgatgaaatggtcgctgaaggacatccggatcgaaggcacatggtgttacccc
gtcacgatctggccgcgcatcatcggcatgatcgcgaacggcaagttcccggttgaaaag
ctcattcacgatctgatcgatgccgacgaagtcgtcgagaaaggctttgacgtactgagc
gacaaaggcagcgacaagatgaagattctcatcaatccccagacacggtga

DBGET integrated database retrieval system