KEGG   Paraburkholderia graminis: CUJ91_08900Help
Entry
CUJ91_08900       CDS       T05548                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
pgp  Paraburkholderia graminis
Pathway
pgp00620  Pyruvate metabolism
pgp00630  Glyoxylate and dicarboxylate metabolism
pgp01100  Metabolic pathways
pgp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pgp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CUJ91_08900
   00630 Glyoxylate and dicarboxylate metabolism
    CUJ91_08900
Enzymes [BR:pgp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     CUJ91_08900
    1.2.1.22  lactaldehyde dehydrogenase
     CUJ91_08900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: AXF09791
UniProt: A0A2Z5LXF7
Position
PHS1_A:2000869..2002323
Genome map
AA seq 484 aa AA seqDB search
MRLDRNYVNGRFLEPAADAGSPTHQALIAVHNPATEALIAHVTAATRAEAVAAVDAAALA
QKAWRKLPSVERGAWLHKLADALTECAPAIGAALALESGKSLADATNEAIYAAQITRYHA
EWARRIEGEVIPSDTPDENLVLHREPIGVVACLIPFNYPVYTFMRKVAPALIAGNTVVVR
PSNNTPTSAFEIAKAVEKAGLPAGVVNILAMDHATAEALCTHPKVGMITLTGSVGAGRKV
LDYCKANIAKPSLELGGKTPAIIEADADLEKAARELVASKTTHCGQLCTAIERVYVQESV
HDRFVALLKRHMSAVEFGDRGEQPSLMGPLVNEASRQSIHAMVERAVAAGATLETGGKLP
ASTERKGFFYPATLLSNCRQDMEIVQEETFGPVMPVVKYRTLDEALEMANDHQFGLSSVL
YTENYRSAMKIANGIEAGELYVNRTPADPYQGFHAGWKRSGLGGDDGKHGMLEFTQTRLV
VMKY
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgcgactcgaccggaactacgtgaacggccgctttctcgaaccggccgccgatgccggt
tcacccacgcatcaggcgttgatcgccgtccacaacccagcgaccgaagcgctcattgcg
cacgtcaccgccgcgactcgtgcggaagccgtggccgccgtcgatgccgccgcgctcgcg
caaaaggcctggcgcaaactgccgtcggtggaacgcggcgcgtggctgcacaagctcgcc
gacgcgctcaccgaatgcgcgccggccatcggcgcggcgctcgcgctcgaatcgggcaag
agtctcgccgatgccacgaacgaagcgatctacgccgcgcagatcacgcgttaccacgca
gagtgggcgcggcgcatcgaaggcgaagtgattccaagcgatacgcccgacgaaaacctc
gtgctgcatcgcgagccgatcggcgtggtcgcgtgcctgattccgttcaactacccggtc
tacacgttcatgcgcaaggtggcgcccgcgctgatcgcgggcaacacggtcgtcgtgcgg
ccaagcaacaacacgccgacctcggcgttcgaaatcgccaaggccgtcgagaaggccggt
ttgcccgcaggcgtcgtcaacattctcgcgatggatcatgcgactgccgaggcgctctgc
acgcatcccaaggtcggcatgatcacgttgacgggcagcgtcggcgcgggccgcaaggtg
ctcgattactgcaaggcgaatatcgcgaagccgtcgctcgaactgggcggcaagacgccg
gccattatcgaagccgacgccgatctggaaaaagccgcgcgtgaactggtcgcgtcgaaa
accacgcactgcggccagctttgcacggcgatcgaacgcgtctatgtgcaggaaagcgtg
catgaccgcttcgtcgcgctgctcaagcgccacatgagcgcagtcgagttcggcgaccgc
ggcgaacagccgtcgctgatgggtccgctcgtcaatgaagcatcgcgtcagtcgattcac
gcgatggtcgagcgcgcggttgcagcaggcgcgacgctggaaacaggcggcaagctgccg
gcatcgacggaacgcaaagggttcttctatccggccacgttgttgtcgaactgccggcag
gacatggagatcgtgcaggaagagaccttcggccccgtgatgccggtcgtcaaataccgc
acgctcgacgaagcactcgagatggccaacgatcaccagttcggtttgtcgtcggtgctt
tacaccgagaactatcgcagcgcgatgaagatcgccaacggcatcgaagcgggcgagttg
tatgtgaaccgcacgccggccgatccgtatcagggctttcatgcgggctggaaacgctcg
ggcctcggcggcgacgacggcaagcacggcatgctcgaattcacgcagacgcgtcttgtc
gtcatgaagtactga

DBGET integrated database retrieval system