KEGG   Paraburkholderia graminis: CUJ91_15860Help
Entry
CUJ91_15860       CDS       T05548                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
pgp  Paraburkholderia graminis
Brite
KEGG Orthology (KO) [BR:pgp00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    CUJ91_15860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AXF09223
Position
PHS1_A:complement(3556764..3557138)
Genome map
AA seq 124 aa AA seqDB search
MSQYEFSVSAQVQFLPEESDPERRQYAFAYTLTIRNTGQVPAQLIARHWVITDSEKTVQE
VKGLGVVGHQPLLKPGEQFEYTSWAVIATPVGTMRGEYFCVAEDGERFDAPVPEFILRMP
RTLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgagccagtatgaattcagcgtgtcggcgcaggtgcagttcctgcccgaagaatcggac
ccggagcgccgccagtacgcgttcgcttatacgctgaccatccgcaacaccggtcaggtg
cccgcgcaattgatcgcgcggcattgggtgatcacggacagcgaaaagaccgtgcaggaa
gtgaagggtctcggcgtggtgggacaccagccgctgctcaaacccggcgagcagttcgaa
tatacgagttgggcggttatcgcgacaccggtcggcacgatgcggggcgagtacttctgc
gtggccgaggacggcgagcgtttcgacgcgcccgtgccggagttcattctgcgcatgccg
cgtacgttgcattga

DBGET integrated database retrieval system