KEGG   Paraburkholderia graminis: CUJ91_24750Help
Entry
CUJ91_24750       CDS       T05548                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
pgp  Paraburkholderia graminis
Pathway
pgp00970  Aminoacyl-tRNA biosynthesis
pgp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgp00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CUJ91_24750
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pgp03029]
    CUJ91_24750
Enzymes [BR:pgp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CUJ91_24750
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CUJ91_24750
Mitochondrial biogenesis [BR:pgp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CUJ91_24750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase Nucleolin_bd DUF745
Motif
Other DBs
NCBI-ProteinID: AXF11107
UniProt: A0A2Z5M3I5
Position
PHS1_B:1479054..1480463
Genome map
AA seq 469 aa AA seqDB search
MTSELLYLDATRLAELIRTREVSPVEVVKAHLDRIDAVDPKVNAIVTVADDALEAARAAE
TAVLSGKALGPLHGVPFTAKDSIDTAGVATQRGSPIFKGRVPDADATSVARLKNAGGILL
AKTNLPEFSYWIESDNLLSGRSNNPWDLERTPGGSSGGESAAIAAGMSPLGLGTDLAISV
RGPAAQTGIVSLKATHGRVPMTGIWPRAPRRFWHVGPMARSIRDLALAFSQLSGPDGHDA
FASSTVPFDAGVGRSPDRPLRVGWMVEPGFGPVDPQVAATVQAAAEALKSLGLVVEPVRI
PALERDFALDVFNRLHVMEMKPAFAEVTAGRAEDELYKMAKTMLALPDTSMRDYIDAEQA
AERLRDGYAEYFRNYDALITHVLPIPAHKHGVETFSINGHTVDATYLQGATVPLNVTGLP
GISMRFGTSKESLPINVQIVGSWQAESTILHVASLLESVSPVRDLHPHI
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgacctccgaactcctttacctcgatgccacccgactggccgaactgatccgcacacgc
gaagtctcgcccgtcgaggtcgtgaaggcacaccttgatcgcatcgacgcggtcgatccg
aaagtcaatgcgatcgtgacggtcgcggacgatgcgctggaagccgccagggctgccgaa
acggcagtgctgtcgggcaaggcgttggggcccctgcacggagtgcccttcactgcaaaa
gattcgatcgacacggcgggcgtggctacgcaacgtggctcgcccatctttaaaggacgc
gttcctgacgccgacgcaactagcgtggcccggctgaaaaatgcaggcggcatccttctc
gcaaaaacgaacttgcccgaattctcgtactggatcgaaagcgacaatctgctcagtggc
cgatcgaataatccgtgggatctggagcgcactccgggcggctccagcggcggcgaatcg
gcggccatcgcagcgggtatgtcgccgctggggctcggcaccgatctggcgatctctgtg
cgcggacccgctgcgcagacaggcatcgtgtcgctaaaggcgactcacggacgcgtgccc
atgacagggatctggccgcgcgccccacgccgcttctggcacgtgggtccgatggctcgc
agcatccgcgacctggcgctcgcgttctcgcagctgtccggtcccgatgggcacgacgct
tttgcaagcagtaccgtcccgttcgatgccggcgtgggccgctcaccagaccgtccgctg
cgagtgggctggatggttgagccgggcttcgggcccgtcgatccgcaagtcgcggcaacg
gtgcaggcggcggcggaagcgctcaaaagtttggggctagtggtggagcctgtacgcatt
cctgccctcgagcgtgacttcgctctcgacgtcttcaaccgcctgcacgtcatggaaatg
aagccggcctttgcggaagtgacagcaggtcgcgctgaggacgaactctacaagatggcc
aaaacgatgctggccctgcccgacacttcgatgagggactacatcgacgctgaacaggcg
gccgagcgtctgcgagacggatacgccgaatacttccggaattacgacgcgctgattacg
catgtgcttccgatcccggctcacaagcacggcgtggagacgttctcgatcaacggccac
acagtggatgccacctatctgcagggcgcaactgtgccgttgaacgtcacgggcttgcct
ggcatctcgatgcgattcggcacgagcaaggaaagcctgccgatcaacgtgcagattgtc
gggagttggcaggctgagtcaaccattcttcacgttgcgtcactactcgaatcggtcagc
ccggtgcgcgatctacatccgcatatttga

DBGET integrated database retrieval system