KEGG   Paraburkholderia graminis: CUJ91_25840Help
Entry
CUJ91_25840       CDS       T05548                                 

Definition
(GenBank) aldehyde dehydrogenase (NADP(+))
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
pgp  Paraburkholderia graminis
Pathway
pgp00040  Pentose and glucuronate interconversions
pgp00053  Ascorbate and aldarate metabolism
pgp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CUJ91_25840
   00053 Ascorbate and aldarate metabolism
    CUJ91_25840
Enzymes [BR:pgp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     CUJ91_25840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AXF11294
Position
PHS1_B:complement(1724874..1726481)
Genome map
AA seq 535 aa AA seqDB search
MSHSSEVTGQITGEMLIGRKAVRGAEQALHAFNPTTGTDIAEPVFGSGTASDVNLACELA
GKAFDPYRQLPLSVRAEFLERIADGITALGDALVERAQQESGLPKARLEGERGRTTGQLK
LFAQVVRSGQWLTATLDSPLPDRKPLPRSDLRMQRIPVGPVAVFGASNFPLAFSVAGGDT
AAALAAGCPVVVKAHRAHLGTSEMVGRVIQRVAAEMDLPEGVFSLIVGAGNSVGEALVAH
PAIKAVGFTGSRAGGLSLMRVAAARPEPIPVYAEMSSINPVFLLSNALKQRTENIARGFV
DSLALGAGQFCTNPGLAIAVDSDALKSFVATASEALAAKPAQTMLTSGIHSAYTEGEGKL
AKTAGVETVARGADVTGPNQARAALFVTDAQTFVATPALEDEVFGPASTIVRCKDEAELL
QVAEHFAGQLTATIQMDAADVPAAQKLVPILERKAGRLLVNGFPTGVEVCHAMVHGGPFP
ATSDSRATSVGTTAIERFLRPVCYQDFPADLLPEALADSNPLNLWRRRDGEITRS
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgtcccattccagcgaagtcaccggccagatcaccggcgaaatgctgatcggccgcaag
gccgtgcgcggcgccgaacaggcgctgcacgcgttcaatcccaccaccggcacggacatc
gccgagccggttttcggcagcggcacggctagcgacgtcaacctcgcctgcgaactggcg
ggcaaggcattcgatccgtaccggcaactgccgctcagcgtgcgcgccgagttcctcgaa
cgtatcgcggacggcatcacggcgttgggcgatgcgctcgtcgagcgcgcgcagcaggaa
tccggcttgccgaaggcgcgtctggaaggcgagcgcggccgcacgaccggccagctcaag
ctgtttgcgcaagtagtgcgctcgggccagtggcttaccgcgacgctcgattcgccgctg
ccggaccgcaagccgctgccgcgttccgatctgcgcatgcaaaggattccggtgggaccg
gtcgccgtgttcggcgccagcaacttcccgctcgcgttctcggtggccggcggcgacacg
gccgcggcgctcgcggccggctgtccggtcgtggtgaaggcgcatcgcgcgcacctcggg
acctcggagatggtcggccgtgtgatccagcgcgtcgcagcggaaatggacctgccggaa
ggcgtgttctcgctgatcgtcggcgcgggcaattcggtcggcgaggcgctcgtcgcgcat
ccggcgatcaaggcggtcggcttcaccggttcgcgcgcgggcggcttgtcgctgatgcgc
gtcgcggcggcgcgccccgagccgattcccgtctacgcggaaatgagcagcatcaacccg
gtgtttctgctgtcgaacgcgctcaagcagcgcaccgagaacatcgcgcgcggtttcgtc
gattcgctcgcgctgggcgccggccagttctgcacgaacccgggcctcgcgattgccgtc
gacagcgatgcgctgaagagcttcgtcgccaccgcctctgaagcgctggccgccaagccc
gcgcagaccatgctgacttcgggcatccactccgcctacacggaaggcgagggcaagctg
gccaagaccgccggcgtcgaaacggtggcgcgcggcgccgacgtaacgggcccgaaccag
gcgcgcgccgcactgttcgtgactgatgcgcagacgttcgtcgccacgccggcgctggag
gacgaggtattcggtccggcatcgacgatcgtgcgctgcaaggatgaagccgagttgttg
caagttgccgagcactttgccggccaactgacggccacgatccagatggacgccgccgac
gtgcccgcagcccagaagctcgtgccgattctcgagcgcaaggccgggcgtctgctggtc
aacggctttccgaccggcgtcgaagtctgccacgcgatggtccacggcggcccgttcccg
gcgacctccgacagccgcgcgacctcggtcggcacgacggcgatcgagcgcttcctgcgc
ccggtctgctatcaggacttcccggcggatctgttgcccgaggcgctggctgacagcaat
ccgctgaatctgtggcgtcgccgcgatggcgagatcacgcgcagctaa

DBGET integrated database retrieval system