KEGG   Planomicrobium glaciei: FK545_08680Help
Entry
FK545_08680       CDS       T06125                                 

Definition
(GenBank) GTP cyclohydrolase II
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
pgq  Planomicrobium glaciei
Pathway
pgq00740  Riboflavin metabolism
pgq00790  Folate biosynthesis
pgq01100  Metabolic pathways
pgq01110  Biosynthesis of secondary metabolites
pgq02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pgq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    FK545_08680
   00790 Folate biosynthesis
    FK545_08680
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    FK545_08680
Enzymes [BR:pgq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     FK545_08680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2 Rad10 DUF977
Motif
Other DBs
NCBI-ProteinID: QDY45492
UniProt: A0A518XMT1
Position
complement(1726013..1726774)
Genome map
AA seq 253 aa AA seqDB search
MTPIKLEPKVFEVLKDKIDLIQMGNEAIYVVGPIRLPVNLHGETVVFQWYCWLKQDEVTN
DYETIIEKLSSANLAEYQQSSVLVYGDFENSEDALIRMHSICHTGDIFGSKRCDCGFQLK
QSMQQIADHGSGALFYLANHEGRGIGLFSKAMAYVLQENGYDTVEANESLGFVDDSRNYD
DAIAVLKSLRTKPVTLMTNNPKKISALENSDLEIAGRISLWGDESEYNAKYLQTKIDRSG
HLEDEGDAVHVKP
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgacaccaatcaaacttgaaccgaaagtgttcgaagtattaaaagataaaattgacttg
atccaaatgggcaatgaagcgatttatgtagtcggacctatccggctgccagtaaattta
catggagaaaccgttgtgttccagtggtattgctggttaaaacaagatgaagtgacgaat
gattacgaaaccatcattgaaaagctgtcttctgctaatttggcggaataccagcaatca
agcgtattggtttatggagatttcgaaaacagcgaagacgcgttgatccgcatgcactcg
atttgccatacaggcgatattttcggcagcaaacgctgcgactgcggattccaattaaag
cagtcgatgcagcaaatcgcggaccacggatccggcgctttgttctatttggcgaaccat
gaagggcgcggcatcggattgttcagcaaagccatggcgtatgtgcttcaggagaacggc
tatgatacggtcgaagccaatgaaagccttggttttgtcgatgattcccgcaattacgac
gatgcaattgccgtattgaaatcgctgcgcactaaaccggtgacgttgatgacaaacaac
ccaaaaaagatttccgcattggaaaattcagaccttgaaattgccggccgcatttcgtta
tggggcgacgagtcggaatacaacgccaagtatttgcagaccaaaatcgatcgctccggc
cacttggaagatgagggggatgctgttcatgtcaaaccatga

DBGET integrated database retrieval system