KEGG   Puccinia graminis: PGTG_00847Help
Entry
PGTG_00847        CDS       T02226                                 

Definition
(RefSeq) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pgr  Puccinia graminis
Pathway
pgr00010  Glycolysis / Gluconeogenesis
pgr00620  Pyruvate metabolism
pgr00640  Propanoate metabolism
pgr00680  Methane metabolism
pgr01100  Metabolic pathways
pgr01110  Biosynthesis of secondary metabolites
pgr01130  Biosynthesis of antibiotics
pgr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PGTG_00847
   00620 Pyruvate metabolism
    PGTG_00847
   00640 Propanoate metabolism
    PGTG_00847
  Energy metabolism
   00680 Methane metabolism
    PGTG_00847
Enzymes [BR:pgr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PGTG_00847
Lipid biosynthesis proteins [BR:pgr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PGTG_00847
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 10543232
NCBI-ProteinID: XP_003319935
UniProt: E3JTZ5
AA seq 670 aa AA seqDB search
MQTSSESTSPQEIPKLPIAPRVKHLASNNKPIDYPSLYRQSLDQSDQFWDQQAKETLSWS
RPYTSIYQGDFQNGNVAWFRDGGLNACYNCLDRWAIKDPNRTAIIWVADEDQDSIELTYK
EVFEEVCRLANVLKSFGVKKGDTVAIYLPMIPAAAIAFLACARIGAIHSVVFAGFSADSL
RDRVVDARSRVVITSDEGKRGGKTIPTKRIVDEALDGIARGLGEHVVEKVIVYSRTGSRV
PMKEGRDVWWNEVCQLARPFCPIEIMDSEDPLFILYTSGSTGKPKGLIHTTAGYLLGAAL
TLKHVFQVQEGDRFACMADVGWITGHTYIIYGPLVNGVATTIFESTPIYPTPSRYWQTVA
KYRFNQFYTAPTAIRLLKKLGASYLDGHDLSSLRVIGTVGEPINPDAWQWYNDHVGKNEC
AVVDTYWQTETGSIIITPLASSTETKPGSATLPFFGIEPTLLEPTTGKIIEGPGSGVLAL
KRPWPSMARTIYGDHKRYLDTYFKPYPGYYFTGDGAGRDSDGYYWIKGRVDDVLNVSGHR
LSTAEVEAAIAQHPWIAETAVVGAPDETTGQSIYAFVILKVEHHQLHSTEQEDQLRKELA
LLVRKSIGPFSNPKKIVIVSDLPKTRSGKILRRVLRKIVSNEVDSLGDLSTLSDPSVVEE
IVHKISASSS
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgcagacttcatcagaatcgaccagtccgcaggaaatcccgaagctgccgatcgctccc
agagtcaaacacttggcctccaacaacaagcccatcgattatcccagcctctaccgccag
agtttggatcagtccgaccagttttgggaccagcaagcaaaagagactctcagttggagt
aggccttacacatcgatctaccagggagacttccagaacggcaacgtggcctggttccga
gacggtggtttgaatgcctgttacaactgtctcgaccgatgggcgatcaaagaccccaac
cgaacggccatcatctgggtcgctgatgaagatcaagatagtatcgaactcacttacaag
gaagtcttcgaggaagtttgccgtttggctaatgtcttgaaatcctttggagtcaagaaa
ggagatacagtcgccatttacttaccgatgattccagctgccgccatagcgtttttggca
tgtgccaggatcggtgcgattcattcggtagtttttgcaggcttttcggcggattcacta
cgagaccgagtggtggatgcccgatcgcgagtggtgatcacatctgacgagggcaaacgt
ggggggaagacaatcccgacgaagcggatcgtggacgaagcattggatgggattgcgcgt
ggattgggtgagcatgtagtggagaaggtgatcgtctattcccggacaggctcgcgagtg
ccgatgaaggagggccgggacgtctggtggaacgaggtctgtcagcttgcccggcccttt
tgtcccatcgaaatcatggacagcgaggacccgcttttcatcttatatacctccgggagt
accggcaaacccaagggtttgatccataccactgctggttaccttctgggtgcagccttg
acgctcaaacacgtcttccaggttcaggagggcgaccggtttgcttgcatggctgacgtt
ggatggatcaccggtcatacgtatatcatatatggacctcttgtgaatggggttgccacg
acgatcttcgagtcgacgccgatataccccaccccatcgcggtactggcagaccgtggct
aaataccggttcaaccaattttatactgccccgaccgctatccgattgttgaagaaacta
ggggcctcgtatcttgacggtcacgacttgagctcgttgagagtgatcggaaccgtgggt
gagccgattaaccccgatgcgtggcaatggtacaatgatcatgtagggaagaatgaatgt
gcggtggtggatacctactggcagactgaaacaggctcgatcattatcactcccctagcg
agctcgactgaaactaagccaggctcagccaccttaccattcttcgggatcgagcccacc
ctgctggagccgacgaccgggaagatcatcgagggcccaggaagcggggtcttagcgctt
aagaggccttggccctcaatggcccggaccatctacggcgatcacaagcgatacctcgac
acttacttcaaaccgtacccaggctattacttcactggtgatggagccggacgggactcg
gacggatactactggattaagggtcgggtagatgatgttttgaacgtgtccggacataga
ttgtcgaccgctgaagttgaagccgccatagcccagcatccatggatagctgaaacggct
gttgtaggggcacctgatgagacgacgggccaatcgatctatgctttcgtgattcttaaa
gtagagcatcatcagctccatagtaccgagcaagaggatcagttgaggaaagagctcgcc
ttgctcgtccggaaatctatcggtcccttctcgaatcctaagaagatcgtcatcgtcagc
gatttacctaagactagatctggaaagattctgaggagggtactgaggaagatcgtttcc
aacgaggtcgacagtttgggcgacttatccacactctctgaccccagcgtggtcgaagaa
atcgttcacaagatttccgcatcttcttcttga

DBGET integrated database retrieval system