KEGG   Puccinia graminis: PGTG_00929Help
Entry
PGTG_00929        CDS       T02226                                 

Definition
(RefSeq) hypothetical protein
  KO
K01225  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
pgr  Puccinia graminis
Pathway
pgr00500  Starch and sucrose metabolism
pgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PGTG_00929
Enzymes [BR:pgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     PGTG_00929
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_7
Motif
Other DBs
NCBI-GeneID: 10543398
NCBI-ProteinID: XP_003320017
UniProt: E3JU73
AA seq 445 aa AA seqDB search
MIGKAVLVWFSILQAISNVDSQSASRFEAEPNLPLEIQTCTVGKGCKRIPGSITLDANWR
SVKDLSGRRDCFNGTAWDKSLCPDPETCAKNCALGTIDYEKEKIATHGNLVNLKLFKDNG
RDGSRIYLLDAQDRYQVFFLLNKELSFDVDVSRSSCGVAGGIYFSAMKPDGGKSSTNQAG
SKYGTGYCDAQGPRDMHFVEGRANLAIGTAGGEGEVGYACPELDVWEANSISQAFTVHNC
QDAKATVCRGEKCRGLCDGPGCDFASFRMGNTSFYGPTKTVDTTKKFTVVTQFITSDNTD
NGELVEIRRFYKQGGRIIQNSKVNLPNASPFDSITNQFCDQIETIFGRSGGFRKLGGLGK
MGAAMRNGMVLVMTIWADKVRGMSWLDGENSDKTHQKPGSARGTCPPGAGQPSNMKKHNP
DAAVEFSDIRVGPIESNFNFKPQAM
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtaaagcagtccttgtatggtttagcattttgcaagcaatctcgaacgtcgac
agccaatctgcaagcagattcgaagcggagcctaacctacctctcgaaatccaaacttgt
acagttggaaaaggctgcaaaagaattccaggaagcataactttggatgctaattggcgc
tcagtaaaggatttgagtggacgacgggattgtttcaatggcacggcttgggacaaatct
ctctgtcctgatccggaaacgtgtgccaagaattgtgctcttggaaccatcgattacgaa
aaagaaaaaatcgccacccatggtaacttggtcaatcttaaattgttcaaagacaacggg
cgagatggatcaagaatttatcttctggacgcacaagatcgataccaagttttttttctc
ttgaacaaagaattatccttcgatgtagacgtgtctagatcttcatgtggagtagcgggc
gggatttacttttctgcgatgaaacccgacggcgggaaatcaagcactaaccaagccgga
tccaagtatgggacaggctattgtgatgcacaagggcccagggacatgcattttgtcgaa
ggaagggcaaacctagccatagggaccgctggcggggaaggcgaagttggctacgcttgc
ccagagttggacgtatgggaggcaaattcgatttctcaagcttttacagtgcacaattgc
caagacgcgaaggctacggtttgtcggggggagaaatgtcgcggattgtgcgatgggccc
ggatgtgattttgcgtcttttcgaatgggcaacaccagcttctatgggccaacaaaaact
gtcgatacaactaaaaaatttaccgtcgtaactcaattcatcacctccgataacaccgac
aacggggaactggtggagatacggagattttacaaacagggtggtcgaataattcaaaac
agtaaagtgaacctcccgaacgcttcgcccttcgattccataacaaatcaattttgtgat
caaatcgaaacaatatttggacgttcgggcggttttcgaaaacttggtggacttgggaag
atgggagctgcgatgcgtaatggaatggttctagtgatgacaatttgggccgataaggtt
cgagggatgagctggttagacggcgagaattcggataaaactcatcaaaaacctggttca
gcgagaggaacttgcccgccaggtgctggccagccatccaacatgaagaagcacaaccca
gatgctgctgttgagttttcagacattcgggtgggtccgatcgagtcaaacttcaacttc
aagccacaggctatgtag

DBGET integrated database retrieval system