KEGG   Puccinia graminis: PGTG_01121Help
Entry
PGTG_01121        CDS       T02226                                 

Definition
(RefSeq) hypothetical protein
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
pgr  Puccinia graminis
Pathway
pgr00520  Amino sugar and nucleotide sugar metabolism
pgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PGTG_01121
Enzymes [BR:pgr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     PGTG_01121
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4
Motif
Other DBs
NCBI-GeneID: 10543782
NCBI-ProteinID: XP_003320209
UniProt: E3JUR5
AA seq 241 aa AA seqDB search
MNMLGLAKRTKARFLLSSTSEVYGSPEQHPQKETYWGNVNPIGPRACYDEGKRVAEALTY
GYARENGVEVRVARIFNTYGPRMSPSDGRLVSNFIMAAIRGEPLEVYGDGQQTRSLMYVF
DLVDGLIKLMNSENHAEVHEGPVNLGSEDEQPVIEWARLIIDIVNNLKSHHPHHHSKASE
EPSKSSVIVHKDPLPDDPPRRRPDSSKAKLFLDWTPKWSAKAGLEDTAKFFFDLVHSGYS
S
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgttagggttggcgaaacgtaccaaagccagattcttgctttcaagcacatct
gaagtctatggatcaccagaacaacatccgcaaaaagagacgtattggggaaacgtaaat
ccgatcgggcctagggcttgttatgacgaaggcaaacgagtagcagaagcgttgacctac
ggctatgcgcgagagaacggagtagaagtacgagtggcgcgaatcttcaacacctatggt
ccccggatgagtccgagcgatgggcggctggtttcaaatttcatcatggcggcaatccgg
ggagagccgttggaagtgtatggggacggccaacagacgcggtcgttgatgtatgtattc
gacttggtcgacggcttgatcaagttgatgaactcggaaaaccatgccgaggtgcatgaa
ggccccgtcaacctgggctccgaggacgaacagccggtcatcgaatgggctagactgatc
atcgatatcgtcaacaacctcaaatctcaccatccccatcatcattcgaaggcttcggag
gagccttccaagtcttccgttatcgtgcataaagacccgcttcctgatgatccccccaga
cgtagacccgactcttcaaaggctaaactgttcctcgattggactcctaaatggtccgct
aaagctggcctcgaagataccgctaaattcttcttcgatctcgttcattctggttactcc
tcttaa

DBGET integrated database retrieval system