KEGG   Puccinia graminis: PGTG_02695Help
Entry
PGTG_02695        CDS       T02226                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
pgr  Puccinia graminis
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 UPF0128 CCP_MauG
Motif
Other DBs
NCBI-GeneID: 10533984
NCBI-ProteinID: XP_003320673
UniProt: E3JW29
AA seq 112 aa AA seqDB search
MGKKDSGGEGDPAIGGKLFGQRCATCHTVEKGAPHKVGPNLHGLFGRKTGQAAGYNYTEA
NVKKGITWSEETLMEYLIDPKKYIPGTKMAFAGLKKEKERANIVAYLKDATK
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagaaagattccggaggcgaaggcgacccagctatcggcggcaaactcttcgga
caacgatgtgctacatgtcacaccgtcgagaaaggcgctcctcacaaagtcggacccaac
ctacatggtcttttcggtcgtaagaccggacaagccgccggttacaactacacagaagcc
aatgtcaagaagggaatcacatggtccgaagagactcttatggagtacctgatcgacccc
aagaaatacattcctggaaccaagatggctttcgctggcttgaagaaggagaaagaacgt
gccaacatcgttgcgtacttgaaggacgccaccaaataa

DBGET integrated database retrieval system