KEGG   Puccinia graminis: PGTG_04308Help
Entry
PGTG_04308        CDS       T02226                                 

Definition
(RefSeq) calcineurin subunit B
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
pgr  Puccinia graminis
Brite
Protein phosphatases and associated proteins [BR:pgr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     PGTG_04308
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_9 EF-hand_4
Motif
Other DBs
NCBI-GeneID: 10542306
NCBI-ProteinID: XP_003322771
UniProt: E3K1Y3
AA seq 175 aa AA seqDB search
MGQTGSQLLQEIEKSSNFTGDEIQRLKKRFMKLDRDQSGSIDKDEFLQIPAIANNPLASR
MIAIFDEDGGGTVDFQEFVDGLSAFSSRGDREQKLKFAFKVYDMDRDGFISNGELFLVLK
MMVGNNLKDQQLQQIVDKTIMEADTDCDGKLSFDEFKQVVANTDIAKQMTLEALF
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgggtcaaacaggatctcaactacttcaagagatcgaaaaatcgtcaaactttacgggt
gacgaaatccagaggttaaagaaacggtttatgaagctcgatcgagatcaatcgggttcg
atagataaggatgaatttctgcaaatcccggcgattgcgaacaacccattggcgtcgagg
atgattgcgatcttcgatgaagacggtggtgggacggtcgatttccaagaatttgtggac
ggtttatcggcgtttagtagtcgaggagatcgagaacaaaagctgaagttcgcgttcaaa
gtgtatgatatggatcgagatggatttatttcgaatggagaattgttcttagttctgaag
atgatggttgggaacaacttgaaagatcaacaactccaacagatcgtggacaagacgatc
atggaagctgatacagattgtgatggcaagctctcgtttgatgaattcaagcaggtcgta
gctaatacagatattgccaaacagatgacacttgaagccctgttttag

DBGET integrated database retrieval system