KEGG   Puccinia graminis: PGTG_05095Help
Entry
PGTG_05095        CDS       T02226                                 

Definition
(RefSeq) hypothetical protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pgr  Puccinia graminis
Pathway
pgr00010  Glycolysis / Gluconeogenesis
pgr01100  Metabolic pathways
pgr01110  Biosynthesis of secondary metabolites
pgr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PGTG_05095
Enzymes [BR:pgr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     PGTG_05095
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim Sbt_1
Motif
Other DBs
NCBI-GeneID: 10533561
NCBI-ProteinID: XP_003324289
UniProt: E3K6D9
AA seq 348 aa AA seqDB search
MSFVKTDSSITIKTSTAQAEIAFHGAHVYSWKVEGKEQLFLSSASSISGPAAIRGGIPIC
FPVFGPPPSREPYASLKQHGFARNTSWKFDGVEEGSDWIEARFSLDSNNPEVQKVFKPAF
ECQYRVKIRERSLVTSLEVTNPSETTFELQALLHTYLRLPDQGSPQDVRLGPLKGLSFAD
KVAQGAVDTEDREAVDFLAGEVDRVYHGVPSKIEVELGHGKKMTIKTDGLPDLTVWNPHE
ARVTRWPTWKTRAGNGSCVSSLAKPVSSPSSRTVLGRALKNSSLIYERNRPLRTIKACLE
EGSPSLTSRSCLLDSSNFEHDVPFLHLYPLILTDFIYLSKNIAAAGFP
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcgtcaagactgactcgtcgatcaccatcaagacctcgactgctcaggcagag
atcgcattccatggggctcacgtctactcgtggaaggtcgaggggaaagagcagttgttc
ttgtcctctgcgtcctcgatctctggaccggctgccattagaggtggaatcccgatctgc
ttcccagtctttggcccaccaccttcaagagaaccgtatgcaagtctcaagcaacacggc
tttgcacgaaacaccagctggaaattcgatggagttgaagaaggaagcgattggatagag
gcccgcttcagcttagattcgaataaccccgaggtccagaaagtgttcaagccagccttc
gaatgtcagtacagagtcaagattagagagcgaagtctggtgaccagtctggaggtgacg
aacccctcggagacgacgttcgagctgcaagcgctcctgcacacctatctccgtctgccc
gaccaaggatcgccccaggatgtccgtctgggcccactgaagggcttgtcgtttgctgac
aaagtggcccagggcgcggtggataccgaggatcgagaggccgtcgacttcctggcgggc
gaggtcgatcgggtctatcatggcgtaccatctaagatcgaggtggagctaggacacggc
aagaaaatgacgatcaagaccgatggactaccggacctgaccgtctggaaccctcacgag
gcaagagtaacgcgatggccgacatggaaaacgagggctggaaacggttcgtgtgtatcg
agcctggccaaaccagtttcgtctccgtcaagccgaacggttcttggaagggctctcaag
aactcgtcgctcatctatgaacgaaaccgcccgcttcggactatcaaagcttgcctcgaa
gaaggaagtccttcactcacttccagatcctgtctacttgattcctccaacttcgaacat
gatgtccccttcctccacttgtatcccctgatcttgaccgactttatatatctcagtaaa
aacatcgctgccgccggctttccataa

DBGET integrated database retrieval system