KEGG   Puccinia graminis: PGTG_08309Help
Entry
PGTG_08309        CDS       T02226                                 

Definition
(RefSeq) hypothetical protein
  KO
K06944  uncharacterized protein
Organism
pgr  Puccinia graminis
Brite
KEGG Orthology (KO) [BR:pgr00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    PGTG_08309
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MMR_HSR1_Xtn TGS MMR_HSR1 FeoB_N
Motif
Other DBs
NCBI-GeneID: 10529728
NCBI-ProteinID: XP_003326772
UniProt: E3KDZ1
AA seq 315 aa AA seqDB search
MSTAVEKIKAIEDEMAKTQKNKATAFHLGQLKAKLAKLKRELLTPSSSGGGGPGVGFDVA
RTGVASVGFVGFPSVGKSSLMSGLTGTQSAVAAYEFTTVVSIIEGAKDGKGRGRQVIAVA
RSCNLLFIVLDVLKPLDDKRIIENELEGFGIRLNKKPPNIIIKKKDKGGISISNTVPLTK
LEPEEIKAVLAEYRMSNCDVAFRCDATLDELIDVIEGNRVYMPCLYVLNKIDAISIEELD
LLYRIPNSVPISVKEWLNIDELIDALWYKLDLVRVYTKPRGRQPDYSQPVVLKTAKCTVE
DFCNAIHKEIAKQMK
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacagcagtagagaaaatcaaggccatcgaagatgagatggccaaaactcaaaaa
aataaagcgacggctttccatttaggccaactgaaagccaaactagccaaactaaaacga
gaactgctaacgccttcgtcgagtggtggtggtggccctggtgtcggattcgatgtggct
aggacaggtgtggctagtgtaggatttgttgggtttccttccgtaggaaagtcttcattg
atgtctggtttaacgggcacacaatctgctgttgctgcctatgaattcacaactgttgtc
agtattatcgagggtgccaaagacggaaaaggacgtggtagacaagtcattgctgttgcc
cggtcgtgtaatcttttattcattgttctggacgtactgaaaccactggatgacaagcgg
attattgaaaacgaattagaaggttttggaattcgtctgaataagaaaccgcccaacata
atcattaaaaagaaggataagggtgggatctcgatctcaaacaccgttccacttaccaaa
ctcgaacctgaagagattaaggctgtgttggccgaataccgaatgagcaattgtgacgtc
gcctttcgatgtgatgctacgctggatgagctgattgatgtgatagaaggaaatcgagtc
tatatgccctgtctatacgtattaaacaagatcgatgctatttcaattgaggagctggat
ttgctgtatcgaattccaaacagtgtaccaatttcagtcaaggagtggttaaatattgat
gaattgatcgacgctctttggtacaaactggacctcgttcgagtgtacacgaaacctcgt
ggaaggcagcctgattattctcagcccgtcgtgctcaagacagctaaatgtacagtcgag
gatttctgtaacgctatccacaaggaaatcgccaagcagatgaaatag

DBGET integrated database retrieval system