KEGG   Puccinia graminis: PGTG_13421
Entry
PGTG_13421        CDS       T02226                                 

Definition
(RefSeq) delta14-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
pgr  Puccinia graminis
Pathway
pgr00100  Steroid biosynthesis
pgr01100  Metabolic pathways
pgr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pgr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    PGTG_13421
Enzymes [BR:pgr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     PGTG_13421
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 PEMT ICMT
Other DBs
NCBI-GeneID: 10538867
NCBI-ProteinID: XP_003332054
UniProt: E3KTR4
AA seq 431 aa
MGKAAETTKRTVVNPRTTEFEFGGRIGALGVTLSVPFFTYWLNLACTPQTGCLLGPKILD
LRTLWNTTSFFSLEACYVYLGWYMYLVLCWLVLPGKSVDGTVLRDGTRLSYKINAFNSLI
CTILLTAGVFARWGDSPFLYIIDHYVELITASLIMSISQAVYCYWSSFQPGRILALGGNS
GNVIYDWFIGRELNPRIASFDIKTFNEMRPGLILWALLDFCWVIKQVHEFGKPSNSILLA
FIFQFWYVFDAEYNEDIILTQMDITTDGFGFMLSVGDLTWVPFTYSLQLVYLSFVPLHLS
NFELALVLAVQLVGYGIFRISNEEKNAFRRRSENPKGLKFMETERGTRLLISGWWGVSRH
PNYLGDWIMAWAWCLPTGISTPITYFYAIYFAILLVHRQMRDEHACEKKYGKADWNKYKK
LVPWKIIPYIY
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgggaaaagcagccgaaacaaccaagcgaactgtcgtcaaccccaggacgaccgaattt
gaattcggcggtcggatcggagcgctcggcgttactttatcggtcccgttcttcacctat
tggctgaatctggcgtgtactcctcaaactggatgtttgctgggtcccaaaatcctggac
cttcggactctatggaacacgacgagcttcttcagtctcgaggcttgctacgtctatctt
ggatggtatatgtaccttgtactctgctggctagtactccctggcaaatcggttgatggt
actgtcttaagagatggtacacgattatcttataaaattaatgctttcaatagtctcata
tgcaccatccttctcacggccggggtgtttgctcgatggggcgactctcccttcttgtat
attatcgatcattacgtcgagttaattactgccagtttaatcatgagtatctcccaagca
gtatattgttattggagcagtttccaacccggtcggatcctagcgcttggtggcaacagc
ggcaacgtaatctacgattggttcatcggtcgagagctaaatccaagaattgcgagcttt
gatatcaaaaccttcaacgagatgcggcctggtctgattttgtgggcgttattggacttc
tgctgggttatcaaacaagtccacgaattcggaaaaccctcaaacagcatcctccttgcc
ttcatcttccaattttggtatgtttttgatgctgaatacaacgaggacataattttgact
caaatggatatcacgactgatggatttgggttcatgttatcggtgggagacttgacttgg
gtaccatttacttattcactgcaactagtatatctctccttcgtaccactacatctctcc
aatttcgaactggcgttggtgctcgctgtccaactcgtgggctacggaattttccgaatt
tcgaatgaagaaaagaacgcctttcgtcgcagatcggagaaccctaaaggcttgaagttt
atggaaaccgaaagagggacgaggcttttgatctccggttggtggggagtgtcgagacat
cccaattacttgggagattggatcatggcatgggcatggtgtttacccacaggcatttcc
accccaattacctacttttatgcgatctactttgctattctattggtccacagacaaatg
agagatgaacatgcgtgcgagaaaaaatacggtaaagccgattggaataaatacaagaaa
cttgttccctggaagattatcccatacatttattga

DBGET integrated database retrieval system