KEGG   Puccinia graminis: PGTG_17443Help
Entry
PGTG_17443        CDS       T02226                                 

Definition
(RefSeq) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
pgr  Puccinia graminis
Pathway
pgr00564  Glycerophospholipid metabolism
pgr01100  Metabolic pathways
pgr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pgr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    PGTG_17443
Enzymes [BR:pgr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     PGTG_17443
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-GeneID: 10531700
NCBI-ProteinID: XP_003336125
UniProt: E3L581
AA seq 168 aa AA seqDB search
MGSSENTQQGQDPTESFVASQPVSPGAGLASSVKVHTDIVRGELETLPSSGNCMFFFVVY
LAPGNYHCFHSPADWKVERCCHFAGLFTPWLHLSLKNGMTIGELFSVSPWMGGELADLFV
LNKRVALLGQWRHGFFSMTPVGAKNVGSILINLNQELRTNWVDKQCHE
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgggcagttctgagaacacgcaacaaggccaggacccaacagagagctttgtggcttcc
cagccagtcagtcctggcgccggcctcgcatcctctgtcaaagttcatacagatattgtc
aggggtgagctcgaaactctgcccagctccggcaattgtatgttcttctttgttgtctat
ctcgccccaggcaattatcattgcttccattctcccgccgactggaaggttgaacgttgt
tgtcattttgctggtttattcactccttggctccatttatctttaaaaaatgggatgact
ataggagaactgttttcagtctcaccgtggatggggggagagctagcagatctgtttgta
ctgaacaaaagagtggccctattgggacaatggcggcacgggtttttctcgatgacgcct
gtaggcgcaaaaaatgtgggctcaatcctgatcaacctcaatcaagagttgcggacaaac
tgggtggataaacaatgtcatgagtag

DBGET integrated database retrieval system