KEGG   Puccinia graminis: PGTG_18178Help
Entry
PGTG_18178        CDS       T02226                                 

Definition
(RefSeq) hypothetical protein
  KO
K03254  translation initiation factor 3 subunit A
Organism
pgr  Puccinia graminis
Pathway
pgr03013  RNA transport
Brite
KEGG Orthology (KO) [BR:pgr00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    PGTG_18178
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:pgr03012]
    PGTG_18178
Translation factors [BR:pgr03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    PGTG_18178
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 10532047
NCBI-ProteinID: XP_003336507
UniProt: E3L6B3
AA seq 1155 aa AA seqDB search
MSDTRSDCQKLGSPEIARHQFLLTVLPLPAPPTYNCLLTTNLHLPLKLATGNFFLQQLQL
EQLHLQVTLSSTIMAPYTKPETVLRRSEELLSVNQPMSALASISEIFSSKRFRQTPLSSL
EPIMLRFIDLCVLLRKTRNVKEGLHMYKNVAQNTSVSSVEMVVQHFITKSKEKLDEALAK
VDEIEGPLVAEGADQENGAALVDDLEATETPESLLMSTVSEEKSRDRTYRELVTPWLRSL
WEAYRTALDILRNNSRLENFYQQIATEAFEFCLTHTRKTEFRRLAETLRSNLASSQKYTN
QAHSINLSDPDVLQRHLETRFQQLNTSVKLELWQESFRTAEDINGLIGLSKKVPKNHVMS
AFYEKMIRVFGVGENHLFHAAAYNKYFTIQANVAADQPDKLKKLSGLVLLSALAVPVVGS
STSTNEPQRKMRDNEEDSNSLNKTKLGRLASLLGLTSLPTRANLLKDALMRGVLKKSSPE
LHSLYEILEVDFHPLSITSKIQPILQQLSEDEETKRYVEPLKEVVLTRLFQQLSQVYDSL
KLNRVIKLASFGDSEPENLKITRIRVEKFLMEACKRGELEVTLDHSSQLIKFTDRMFENE
TNSQISSTQLPTSNIPSLLSFNKDQDLVPTQSLAKSGVLQPNSASLLRTHLTRLASALTV
SLNHIMPVLSTINETATPDLHLVKSVALQALQIDGPKQRKMLQKRKVTIEERKRKVEELR
QKQDIEEAKAKALRIIQIQEEQQIRLQKQNKEREIKKLKDEADKIRAAEAEKVAMALAAQ
AGLNVDIKNLKGVDTNTIIQMGVEQIEKEKKELAAKMKTVNKRLDHTERAMRREEIPLLA
EDYKLQQIRDETNMKKLQEELVEGLQTKHANEVTIKHKLQKMMPDFLKFKERIANQRGHD
YKKAKEESLIKIEQAKIERRAQVVKERKLAKAKAAEELKMKEEEERLEEERKKKQAEIDE
QERILKAEAEAKAKAMREEREKERAAAAEMAAKQAQREAEAMAKRENKKLAERAAAPPSA
GPAAPTAEPWRRTGPGIGAGAEAGAIVSGVAASAAEARPPVVAELKRPTILPGATKAGGW
RERLAMKGGEESESTSPVGGLSRVSSASGTRRDNLPPPSTGTGGSGNAYKPPQNRTEPGS
GANSRTPSGRGASRW
NT seq 3468 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatactcgatcggactgtcagaaactcgggtcgcctgaaattgctcgtcatcag
ttcttgttgaccgttctccccctgccggctccccccacctacaattgcctgttgaccacc
aacttgcacttgcccctcaaacttgcaaccggcaacttcttcttacaacaacttcaactt
gaacaacttcaccttcaagtcactcttagcagcaccatcatggcgccctataccaaacct
gagaccgtgcttaggcgctccgaggagctcctctcggtcaaccaacccatgtccgccttg
gcatcgatctctgaaatcttctcctccaagcgattcagacaaacacccctctcctcactc
gaaccgatcatgttacgattcatcgatctctgtgtcctcctcagaaaaactcggaacgtc
aaggagggtctacacatgtacaagaatgtagcccaaaacactagcgtcagtagtgtcgaa
atggtcgtccagcacttcatcaccaaatccaaggagaagttggacgaagccttggctaag
gtggatgagatcgaagggccactcgtcgccgaaggagctgaccaggagaacggcgccgct
ctcgtcgatgatctcgaggctaccgaaacccctgagagtttgctgatgtccaccgtcagc
gaggaaaaatctagagatcgtacctatcgagaattagttaccccatggctgagatcgctc
tgggaggcctatcgaactgctcttgacatactcaggaacaattctcgtctggaaaacttc
taccagcaaatcgccaccgaggccttcgagttctgtctcacccacacccgcaagaccgag
tttagaagattggcagaaactttgcgatcgaacctcgcatcatcccaaaaatacaccaac
caggcccactccatcaacctgtccgatcctgatgtgcttcagcgtcatctcgagactcgc
ttccagcagctcaacacatctgtcaagcttgagctatggcaggaatccttccgcaccgct
gaagatatcaacgggctcatcggtttgagcaaaaaggtacccaaaaaccatgtcatgagt
gccttctacgaaaagatgatccgagtctttggcgtgggtgagaaccacttgttccacgcg
gctgcttacaacaagtatttcaccatccaagccaacgttgcggccgatcaaccggacaaa
ctcaaaaagttatccggtcttgtcttgttatctgccttagccgtaccggtcgttggctcg
agcacatctaccaatgaacctcaaaggaagatgagagacaacgaggaggactcaaacagc
ttgaacaagaccaaactgggtcgtctcgctagcctgctggggttgacttccttgcccact
cgtgcgaacctgttgaaggacgctctgatgagaggagtactgaagaagtcgtcgcccgag
ctgcactcgttatacgaaatccttgaagtcgactttcatccactctcgatcacttccaag
atccaacccatcttacagcagctttctgaggatgaagaaaccaagcgatatgtcgagcca
ctgaaagaggtcgtgctcactcgtctcttccaacaactctcccaagtgtacgattccctg
aaattaaatcgagtgatcaaattagcatccttcggagattctgagcctgagaacttgaaa
atcactcgcattagagttgagaagtttttgatggaagcttgcaaacgtggtgaattggag
gtgacgttggaccattcaagccagctgatcaagtttacagatcggatgttcgaaaacgaa
actaacagtcagatcagctcaacccaacttccgacttcgaacattccatccttactgagc
ttcaacaaggaccaagacttggtccccactcagagtctcgccaaaagtggcgtccttcaa
cccaactcggccagcttacttcgtactcatctaacccgcttggccagcgccctcacagtc
tcgctcaatcacatcatgcctgttctgtcgacgatcaatgagactgccacaccagacctt
catctggtgaaatcggttgccctgcaagccttacagattgacggtcctaaacagagaaag
atgctacagaaacggaaggtgacgatcgaagaacgaaaacgaaaggtcgaagagctcagg
cagaagcaagatatcgaggaagcaaaagctaaggcgctgaggatcatccaaatccaagaa
gaacaacagattcgcctgcagaagcagaataaggagagagagatcaagaaactcaaggat
gaagctgataaaattcgggcggctgaagccgagaaagttgctatggcgttggctgctcag
gccggtctgaacgttgatatcaagaacttgaagggcgtagataccaacacgatcattcaa
atgggagtcgaacaaatcgaaaaggagaagaaagagttggcagcgaaaatgaaaacggtc
aacaaacgattagatcataccgaacgagccatgcgacgagaagagattcccctgttggcg
gaggactacaaactccaacaaatcagggatgagacgaatatgaagaagttacaagaggaa
cttgtcgaaggattgcaaactaagcacgcaaatgaggtgacgatcaaacacaagttgcag
aagatgatgcccgacttcctcaaattcaaagaacggatagccaaccaacgaggccatgat
tacaagaaagccaaggaagaatcgctgatcaagatcgagcaagcgaagatcgagcgtcgt
gcccaggtggtcaaggagcgcaagcttgcgaaagccaaggcggccgaggagctcaaaatg
aaggaggaggaggagcgactcgaagaggaacgcaagaagaagcaggcagaaattgacgag
caggagcgcatcctcaaggccgaggccgaggctaaagctaaagccatgcgtgaggaacgt
gagaaagagagggctgctgctgctgaaatggctgctaaacaagcccagagagaagccgaa
gctatggctaagagagaaaataaaaaactcgccgaacgagccgctgctccaccttccgct
gggccggcagcaccgacggctgaaccatggcgacgaacgggaccaggaatcggagcaggc
gcggaggcgggggcgatagtgagtggggtagcggcgtcggcggctgaagcccgaccaccg
gtggtagctgagctcaagcggccgacgatcctgcccggtgcgaccaaggcgggtggctgg
cgagagcgactggcaatgaagggtggcgaggagagcgagagcaccagcccggtcggcggc
ctcagtcgcgtttcctccgcctcgggcacccgccgcgacaatcttccgcctccttccacc
ggaacgggtggctccggaaacgcctacaaacctccccagaatcgtaccgaacctggctcg
ggagctaattcaagaaccccgagtggaagaggtgcctccagatggtag

DBGET integrated database retrieval system