KEGG   Puccinia graminis: PGTG_18746Help
Entry
PGTG_18746        CDS       T02226                                 

Definition
(RefSeq) hypothetical protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pgr  Puccinia graminis
Pathway
pgr00010  Glycolysis / Gluconeogenesis
pgr00020  Citrate cycle (TCA cycle)
pgr00620  Pyruvate metabolism
pgr01100  Metabolic pathways
pgr01110  Biosynthesis of secondary metabolites
pgr01130  Biosynthesis of antibiotics
pgr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pgr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PGTG_18746
   00020 Citrate cycle (TCA cycle)
    PGTG_18746
   00620 Pyruvate metabolism
    PGTG_18746
Enzymes [BR:pgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PGTG_18746
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 10539223
NCBI-ProteinID: XP_003337146
UniProt: E3L852
AA seq 478 aa AA seqDB search
MLGVLSRHALSASLLRRSTASTRQIHSSAQAYALSKFSMPAMSPTMTEGGIASWKKKEGE
SFAVGDVLLEIETDKATMDVEAQDDGKMAKIIMADGSKAVPVGKAIAIFAEEGEEVSSSE
LEKLISESEASAAPTSKEPSEPKSSKPEPAKESSKSSSPPSSSSSPSSKPSTQSAPRSAI
FATPAAKRIALEKGIPLASIKGSGPNGRILESDLTSYSKAGGASTASSASASGAPYEDLP
VSNMRRTIANRLGASKRDVPHYYLTSEIQMDRVNRLRALFNKAAEERAASSKAGGLKAPT
KLSVNDFVIKASALACADVPEVNSSWQEDFVRQNHHVDISVAVATPTGLITPIVTNVGSR
GLGSISAEIKALATKAKNNQLTPPEYQGGTFTVSNLGMFGSVSHFTAIINSPQSCILAVG
GAEKKLAIDEDPAGKGFKEIEVMKVTLSCDHRVVDGAVGARWLKAFKGYMENPLSFML
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgctcggtgtcctctctcgtcatgccttatcagcttcacttctcaggcggtcaacagcc
tccactcgccaaatccacagctcggcacaggcttatgcactcagcaagttctcaatgccc
gccatgtcccccacgatgactgagggtggaatcgcaagttggaagaagaaagagggagaa
agctttgcggttggggatgtcttacttgagatagaaactgataaagctaccatggatgtg
gaagcccaggacgatggaaaaatggccaagatcattatggccgatggatcaaaagcggtt
ccagtcggaaaagcgattgcaatctttgccgaggaaggggaagaggttagcagtagcgaa
ttagaaaaattgatctcggaaagcgaagcctcggcagcaccaaccagcaaagaaccctcc
gagcccaaatcctccaaaccagaacctgccaaggagagctccaagtcatccagccctcca
tcttcatcaagctccccctcctccaaaccatccacccagtccgctccacggtctgcgatt
ttcgccaccccagccgccaagcgcatcgcacttgaaaaggggattccattggcttcaatc
aagggatccgggcccaacggacgcatcctcgaatccgacctaacctcgtactcgaaagct
ggaggagcttcaaccgcctcttccgcctcggcttccggtgctccctatgaagacctcccg
gtatccaacatgagaaggacgattgccaatcggttgggcgccagcaagcgtgacgtacct
cactactacttgacatccgagattcagatggatcgggtcaaccgtctccgggcgctcttt
aacaaggctgccgaggaacgagctgcttcttcaaaagctggtggactgaaggcacccact
aaattgagtgtcaatgacttcgtcatcaaggcctctgccttggcctgtgcagacgtcccc
gaagtgaactcgagctggcaagaagacttcgttagacaaaaccatcacgtagacatttca
gtggcagttgccacaccaaccggtctgatcacaccaattgtgacgaacgtaggaagtcga
ggtttaggttcgatttcagcggaaatcaaagccttggcaacgaaggcgaagaacaaccag
ttaaccccaccagaataccaaggcgggaccttcaccgtctcgaatttagggatgttcggc
tccgtcagccacttcacggcgatcatcaattcccctcaatcttgcatcttggctgtcggt
ggggccgagaagaagttggcgatcgacgaggatcctgccgggaaaggattcaaagagatc
gaggtcatgaaggtcactttaagctgtgatcatcgtgttgttgatggggctgttggagct
agatggctgaaagcattcaagggttacatggaaaacccactttcattcatgctctaa

DBGET integrated database retrieval system