KEGG   Puccinia graminis: PGTG_19272Help
Entry
PGTG_19272        CDS       T02226                                 

Definition
(RefSeq) hypothetical protein
  KO
K05864  peptidyl-prolyl isomerase D [EC:5.2.1.8]
Organism
pgr  Puccinia graminis
Brite
KEGG Orthology (KO) [BR:pgr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pgr03110]
    PGTG_19272
Enzymes [BR:pgr01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     PGTG_19272
Chaperones and folding catalysts [BR:pgr03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    PGTG_19272
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_2 MIT Laminin_II
Motif
Other DBs
NCBI-GeneID: 10543662
NCBI-ProteinID: XP_003337736
UniProt: E3L9U2
AA seq 221 aa AA seqDB search
MGGEHRRTRPSLRSTSGRITLDDEKIEYIETCLKIATKLKQIATSAFKEGNFEVAAKKYI
KAVAYLDTHTVLPDGCKDEEIESYTSLRVTILLNAGLASIKAASQPGVSPPVAKKHARAA
MKYCSRVLDMHHSAEQPLQKSKQGLIGCYKELTNDERAKALYRRALAGVIVEETDVSLKD
LTEAHRLVPADQAIKKELERVRLQIDNQRKKERAAFGKMFG
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgggaggggagcaccgccgcacccgtccctccctccggtcgacgagtgggaggatcacc
ctagatgatgaaaagatcgaatacattgagacctgcctcaagatagccaccaaactgaaa
cagattgcaacgagcgcattcaaagagggtaacttcgaggtggcagccaagaaatatatc
aaagctgttgcttatctagacactcatacggtcttacccgatggctgcaaggacgaggag
atcgagagttacacgtccctacgggttactatccttttgaacgctggtctggcttcgatc
aaagctgccagccaacccggggtatcccccccagtggccaagaagcacgcccgagctgcg
atgaagtactgtagcagggtcttggacatgcaccactcggctgaacagccactccaaaag
tctaagcagggcttgatcggatgttacaaggagctaactaatgatgaacgagcaaaggca
ctctatcgacgggcattagctggggtgattgtcgaagagactgatgtcagtttgaaagat
ctgaccgaggcccatagactggtacccgccgatcaggctatcaagaaggaactcgagcga
gtccgacttcagattgataaccaacggaagaaggagagagcagcatttgggaagatgttt
ggttga

DBGET integrated database retrieval system