KEGG   Puccinia graminis: PGTG_21853Help
Entry
PGTG_21853        CDS       T02226                                 

Definition
(RefSeq) hypothetical protein
Organism
pgr  Puccinia graminis
SSDB OrthologParalogGFIT
Motif
Pfam: Septin
Motif
Other DBs
NCBI-GeneID: 13542019
NCBI-ProteinID: XP_003889440
UniProt: H6QSR8
AA seq 142 aa AA seqDB search
MLNGHRRLQSKVPLREAGVHLRLKVAGTPGYGDFINNAELKLVEIEFMKCLHTKVNLILV
IAIADTMTDDEITAFKQQRKIPFAIVGLDSEVQTADGRKCRGHQYPGGIIKVDNEEHCRT
AKVSEVATKSTAVIAILLHVYL
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgctgaacggccacagacgattgcaatccaaagtacctctacgggaagctggtgttcat
ctgagacttaaagtagccggcactcctggctatggcgatttcatcaacaacgctgaactc
aagctagttgaaatagaattcatgaagtgtcttcacaccaaagtgaaccttatcctggtg
atcgccatagcagacacgatgacggacgatgaaatcaccgctttcaagcaacagcggaaa
attccatttgccatcgtcggcttggactcggaagtccaaacagctgatggacgcaaatgt
cgcggacatcaatatccggggggaattatcaaagtggataacgaggagcattgtcgaaca
gcaaaagtatccgaagtggctaccaagtctaccgcggttatagctatactcttgcatgtc
tatttataa

DBGET integrated database retrieval system