KEGG   Pedobacter ginsengisoli: CPT03_04360Help
Entry
CPT03_04360       CDS       T05145                                 

Definition
(GenBank) beta-N-acetylhexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
pgs  Pedobacter ginsengisoli
Pathway
pgs00511  Other glycan degradation
pgs00520  Amino sugar and nucleotide sugar metabolism
pgs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CPT03_04360
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CPT03_04360
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pgs03110]
    CPT03_04360
Enzymes [BR:pgs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CPT03_04360
Chaperones and folding catalysts [BR:pgs03110]
 Intramolecular chaperones
  Others
   CPT03_04360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b Fn3_assoc CHB_HEX_C_1 Glycohydro_20b2
Motif
Other DBs
NCBI-ProteinID: ATP55754
UniProt: A0A2D1U2M0
Position
1068782..1070662
Genome map
AA seq 626 aa AA seqDB search
MNFRFFRTAIFTICMLFSINVFAAEDGPALIPQPVKLQKLPGSFKITKGTRLIANTENKE
IAELFSAMIKAPTGFTLGNTAGGTSAIQLVINKTYNKQIGSEGYTLEVKPSKTTIIANLP
AGLFYGMQTLMQLLPKEIESPNVVKNKIWSVPCVKIIDYPRFGWRGLMLDVSRHYFPKEV
VKKYINQLAKYKMNVFHWHLTDDQGWRIEIKSLPQLTAIGAWRAPRVGLWWKRDPQAANE
VADYGGYYTQEDVKEIVKYAQQRFVTILPEIDVPGHSLAALAAYPDLSCTGGPFKVNVGN
TFYGVDDNALCPGNEESFSFMEKVLGEVAALFPGQYIHIGGDECFKGFWKDCKKCQKRMK
DEKLNTPEELQSYFIRRMENIVKSKGKKMMGWDEILEGGLAPEATVMSWRGMKGGIEAAK
MNHHVVMTPADNCYLDLYQGDPAAEPPTYSMLTLSSCYNFEPIPSEIPDPSLILGGQGNL
WTESVPNYRHAEYMTWPRAFALAEVFWSQKERKGWDGFISRMERNLERYDVANINYARSV
YDATIKPLKDSVNKTMRIALSTEIKKLDIYYTFDNTFPDNFSPRYTDTLSIPKGADHLRV
LTYHNNKPIGKMITVSIKDLEKRTED
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcagattcttcaggaccgcaatatttacaatttgcatgctgttctccataaac
gtatttgcggcagaagatggtccagctcttattccgcaaccagtaaagcttcaaaaatta
ccaggtagctttaaaataaccaagggtaccagacttattgcaaacacggaaaataaagaa
atagcagagctgttttccgctatgattaaagcaccaacaggctttacattaggtaataca
gccggtggaacttcagctattcaattggttatcaataaaacttacaataagcagataggt
agcgaaggttatactttagaggtaaagccatctaaaactacaattatagccaatcttccg
gcagggcttttttatggcatgcaaaccctaatgcaactccttccaaaggaaatagaaagt
cccaacgttgttaaaaacaaaatatggtctgttccatgtgttaaaataatagactaccct
aggttcggctggagaggcttaatgcttgatgtaagccggcactattttccaaaggaggta
gttaaaaaatatattaaccagctcgccaaatacaaaatgaatgtatttcactggcattta
accgatgaccagggatggagaatagaaattaaaagcttgccgcaacttacagcgataggg
gcctggcgagcaccaagagtggggctgtggtggaaacgtgatccacaggcagccaatgaa
gtggcagactatggtggatactatactcaggaagatgttaaggaaatagttaaatatgct
cagcagcgctttgtaaccattttgcccgaaatagatgttcccgggcatagccttgctgcg
cttgctgcttatcctgatttgtcatgcacgggcgggccttttaaggtcaatgttggcaat
accttttatggtgttgatgacaatgcactatgtccggggaacgaagaaagtttcagcttt
atggaaaaagtacttggagaggtggcagcgctttttcctggtcagtatattcatattggt
ggtgatgagtgttttaaagggttttggaaagactgtaagaaatgccagaaaagaatgaaa
gatgaaaaactaaacactccagaggagctgcaaagctatttcatcaggcgtatggaaaac
attgtgaagtctaaagggaaaaaaatgatgggatgggatgaaatactggaaggcgggctg
gcacctgaggctactgtaatgagttggagaggaatgaaaggcggtattgaagctgcaaaa
atgaatcaccatgtagtaatgaccccagccgacaactgttatcttgacctttatcagggc
gatccagctgcagaacccccaacttattccatgcttactttatccagctgttataatttt
gaacctattccgtccgaaatacctgatccttcgctaatattagggggacagggtaatttg
tggacagaatctgttccaaattaccgccatgcagaatacatgacctggccacgtgctttt
gctttagccgaagtattctggtcgcaaaaagagcgtaaaggatgggatggctttatctcc
cggatggagcgcaatttggaaagatatgatgtggcaaatataaactatgcaagaagtgta
tacgatgcaacaattaaacctttaaaagactctgttaataaaacaatgcgcattgcattg
agtacagagataaagaagctggatatctattatacatttgataacacttttcctgataat
ttttctccaaggtataccgatacgctttctatacctaaaggtgctgatcatttaagggta
ttaacttatcataacaataagccaataggtaaaatgattacagttagcataaaagatctg
gaaaaacgcacagaagattaa

DBGET integrated database retrieval system