KEGG   Porphyromonas gingivalis TDC60: PGTDC60_0624Help
Entry
PGTDC60_0624      CDS       T01516                                 

Gene name
pckA
Definition
(GenBank) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
pgt  Porphyromonas gingivalis TDC60
Pathway
pgt00010  Glycolysis / Gluconeogenesis
pgt00020  Citrate cycle (TCA cycle)
pgt00620  Pyruvate metabolism
pgt01100  Metabolic pathways
pgt01110  Biosynthesis of secondary metabolites
pgt01120  Microbial metabolism in diverse environments
pgt01130  Biosynthesis of antibiotics
pgt01200  Carbon metabolism
Module
pgt_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pgt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PGTDC60_0624 (pckA)
   00020 Citrate cycle (TCA cycle)
    PGTDC60_0624 (pckA)
   00620 Pyruvate metabolism
    PGTDC60_0624 (pckA)
Enzymes [BR:pgt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     PGTDC60_0624 (pckA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33 FrhB_FdhB_C
Motif
Other DBs
NCBI-ProteinID: BAK24793
Position
654518..656125
Genome map
AA seq 535 aa AA seqDB search
MSKLDLTKYGILNATEIIHNPSYEFLFEEETKAGLEGFEKGQLTELGAVNVMTGVYTGRS
PKDKFFVMDDTTKNTIWWTSDEYKNDNKPVTPEAWKSIKKLAVEQLSGKRLFVVDTFCGA
NESSRLKIRFIMEVAWQAHFVKNMFIRPTEEELANYGEPDFVVMTASKAKVENYKELGLN
SETAVVFNLTEKVQVILNTWYGGEMKKGMFSYMNYLLPLRGMASMHCSANTSMDEKETAI
FFGLSGTGKTTLSTDPKRKLIGDDEHGWDKDGIFNFEGGCYAKVINLSRENEPDIYNAIR
RNALLENVTVDAAGKIDFGDKSVTENTRVSYPIYHIENIVKPVSKAGHAKKVIFLSADAF
GVLPPVSILTPEQTKYYFLSGFTAKLAGTERGITEPTPTFSACFGAAFLSLHPTKYAEEL
VKKMEMVGATAYLVNTGWNGTGKRISIKDTRGIIDAILDGSIDKAPTKAIPFFDFKVPTA
LPGVDPNILDPRDTYADAAEWTTKAKDLAERFIKNFVKFTGNDAGKALVAAGPKL
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaattagatttgacaaagtatggcattctcaatgccactgagattatccacaac
ccatcttacgagttcctttttgaagaagagaccaaagccggtctcgaaggctttgagaaa
ggacagcttaccgaactgggagcagtcaatgtgatgaccggtgtctatacgggtcgttcg
cccaaggataagttcttcgtcatggacgatacaaccaaaaacaccatctggtggacgtcg
gacgaatacaagaacgacaacaaaccggtgactccggaggcgtggaagagtatcaaaaag
ctggccgtggagcagctctccggcaagcgtcttttcgtcgtggacacgttctgcggcgcc
aacgaaagctctcggttgaaaatccgctttatcatggaggtggcctggcaggcccacttc
gtcaagaatatgtttatccgccccacggaagaggagcttgccaactacggcgagcccgac
ttcgtggtgatgactgcttccaaagcgaaggtggaaaactacaaagagctgggactgaac
tccgagacggccgtcgtattcaacctgaccgagaaggtgcaggtgatcctgaacacatgg
tacggcggtgagatgaagaaaggtatgttctcctacatgaactacctgctccctctgcgc
ggtatggcttcgatgcactgctccgccaatacgagcatggacgagaaggagacggctatc
ttcttcggtttgtccggtacgggcaagaccacgctcagtacggatccgaagcgcaagctg
atcggcgatgacgagcacggctgggacaaggacggtatcttcaacttcgaaggcggatgc
tacgccaaggtgatcaacctgagccgcgagaacgaaccggacatctacaatgccatccgc
cgcaatgcgctgctggagaacgtgaccgtggatgctgccggtaagatcgacttcggtgac
aaatccgtgacggagaatactcgcgtctcttatccgatctaccacatcgagaacatcgtg
aagcccgtatccaaagccggccatgccaagaaggtgatcttcctctcggccgatgctttc
ggcgtattgcctcccgtttccatcctgactccggagcagaccaagtattacttcctctcg
ggctttaccgccaagctggccggtaccgagcgtggcatcacggagcctacgcctacgttc
tccgcttgcttcggagcggctttcctctcgcttcatcctacgaagtatgccgaggagctg
gtgaagaaaatggagatggtgggagctacggcttacctcgtcaatacgggttggaacggt
acgggcaagcgcatctctatcaaggatacgcgcggtatcatcgatgccatcctcgacggc
tccatcgacaaggctccgaccaaggctattcctttcttcgacttcaaggtgccgacggct
ctgcccggtgtggatccgaatatcctcgatccgcgcgacacctatgccgatgccgccgag
tggacgacgaaagcgaaggatctggccgaacgtttcatcaaaaacttcgtcaagttcacg
ggcaatgatgccggcaaggctctcgtagcagcagggccgaagctctaa

DBGET integrated database retrieval system