KEGG   Porphyromonas gingivalis TDC60: PGTDC60_0670Help
Entry
PGTDC60_0670      CDS       T01516                                 

Gene name
galM
Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
pgt  Porphyromonas gingivalis TDC60
Pathway
pgt00010  Glycolysis / Gluconeogenesis
pgt00052  Galactose metabolism
pgt01100  Metabolic pathways
pgt01110  Biosynthesis of secondary metabolites
pgt01120  Microbial metabolism in diverse environments
pgt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pgt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PGTDC60_0670 (galM)
   00052 Galactose metabolism
    PGTDC60_0670 (galM)
Enzymes [BR:pgt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     PGTDC60_0670 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: BAK24836
Position
707436..708503
Genome map
AA seq 355 aa AA seqDB search
MNQISLPQRSSFASCLNGKDVDLYHLTNGKGIDAYITNYGARIVALIVPDKDGNRTDVVL
GHDSLQEYIDSEEQYFGAVCGRYANRIARGSFSIDGRCYSLPINNGPNSLHGGISGFNTK
VWEVKSAGPSSLVLEYVSADGEEGYPGELVVRIVYSVTDEGALHIDYRATADAPTVLNLT
NHSYFNLSGAGDPSVHDHTLMIQARYYLPTDDTAIPYGEPAEVEGTPFDFLTPHGIGDRI
DSAMDQLIWAKGYDHTFIVDKPSGAYGFCSRCVSPKTGIVLDVYSSEPGMQVYTGNWMSG
KLRGKFDRRYPARSAVCFETQHYPDSPNKPNYPTTLLRPGEVFESRTAFRFGIVE
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagatcagccttccgcaacgatcctcctttgcctcctgcctgaatggtaaggac
gtggatctctaccatttgaccaatggaaaaggaatagacgcttatattaccaactacggt
gcccgaatcgttgccctcatcgtgccggacaaagacggcaatcggacggacgtcgtcctg
gggcacgactccctgcaggaatacatcgactcggaggagcagtatttcggtgccgtctgc
ggcaggtatgccaacaggattgcccgcggttctttctccatagacggcagatgctacagc
ctgccgatcaacaatgggccgaactctctgcatggcggcatcagcggatttaatacgaag
gtctgggaggtgaaatccgccggcccctcttcgcttgtgctggaatacgtgtcggcagat
ggagaggaggggtatccgggcgagctggtcgttcggatcgtttacagcgtcacggatgag
ggcgcattgcacatagactatcgtgctacggcggatgctcctacggttctgaatctgacc
aatcactcctatttcaatctctcgggtgcaggcgatccctccgtgcatgatcataccctc
atgatacaagcccggtattatctccccacagacgataccgccatcccttacggcgagcct
gccgaggtcgaggggacgccgttcgatttcctcacgcctcacggcataggggatcggatc
gacagtgcgatggatcagctcatttgggcaaagggatacgatcatacctttatcgtggac
aagccgtcgggggcatatggcttttgcagccgttgcgtatcgcccaagaccggaatcgta
ttggatgtctattcctccgaaccgggtatgcaggtgtacacgggcaattggatgagcgga
aagctgagggggaagttcgaccggcgttatccggctcgctcggccgtttgtttcgagacg
cagcactatcccgattcgccgaacaaaccgaattatcctacgaccctcttgcgcccgggc
gaagtgttcgagtcccggacggcgttccgattcggtatcgtcgagtga

DBGET integrated database retrieval system