KEGG   Porphyromonas gingivalis TDC60: PGTDC60_1077Help
Entry
PGTDC60_1077      CDS       T01516                                 

Definition
(GenBank) hypothetical protein
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pgt  Porphyromonas gingivalis TDC60
Pathway
pgt00250  Alanine, aspartate and glutamate metabolism
pgt01100  Metabolic pathways
pgt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pgt00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PGTDC60_1077
Enzymes [BR:pgt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     PGTDC60_1077
Peptidases [BR:pgt01002]
 Cysteine Peptidases
  Family C44
   PGTDC60_1077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase
Motif
Other DBs
NCBI-ProteinID: BAK25234
Position
1110018..1111646
Genome map
AA seq 542 aa AA seqDB search
MKIVSDFTLVLPNKDIDISVGYSAGFIFDGNRHLTSQELQAFFQEASDWDDFLSRAKRIT
GEWAVVFQRAEGEVWAATDHRSSQRLYFRLAADGLRMAENGYSLFTKRDSWDDDAVLFFL
RWGYTPADSTLIREIRKLPPGHALRYRVGEGITTTAYDTVDRYAPFDSHLLSYEEAKEEL
KHRLILAGKRLVRYLNGRPAILPLSGGFDSRMIAYMLHRLNYPHVYCISYGKEGNPDSLK
AAKVADKLGFPFVYINSVRPDRPDYTQDAEFLSYMYNMTGLSSCYYYQEFIAAASIASGS
VHNGMVSFPSNAVVLPGHQGDDLGGSQLMYSHLAESKLSPNKLSHILYSHKQMNQQFDRK
QKERLLSIQAKLFSSYDKEQQPAYRTFEQYMQWENIPKYMLNSQQSWRFFGLDTVCMLLD
KELLDFAYSLPFEYRYGKRIYDDICRELYGEKGISFSDDLNLHGIISSPVYRLKRSLKPL
LRPFIPRPSIWKGDIIGFERIMQPVLRQVEQDGRFHPTSINGLSFCWYLLQNEKLIDRPL
PL
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagtctcagacttcactcttgtgcttcctaataaagatattgatatatcagtc
ggttattccgcaggttttatttttgatggaaaccgacatctcacatcccaagagctgcaa
gccttttttcaggaggcatcggattgggatgacttcctttcccgagctaagcgtattaca
ggagaatgggctgtcgtattccaacgtgccgaaggcgaagtctgggctgccaccgaccat
cgctcttctcagagactctatttccgtcttgcggcggacggactccgtatggcagaaaac
ggttactcactgttcaccaagcgagatagctgggatgatgacgctgttctctttttcttg
cgttggggttatacacctgctgatagcacattgatccgcgaaatacggaaacttcccccc
ggtcatgccctacgctatagagtcggagagggtattacgaccactgcctatgacacagta
gaccgatatgccccgtttgacagccatcttttatcttatgaagaggctaaagaggaactg
aagcaccgccttattcttgccggcaagagactcgttcgctatctgaatggcagaccggcc
atacttcccctttccggaggattcgactcgcggatgatagcctacatgctgcatcgtctt
aattacccacatgtctattgtatctcctatggtaaagagggaaatcctgatagcttgaaa
gctgctaaagtggcggacaaactcggctttccattcgtctatatcaacagtgtacgaccc
gaccgacccgactatacgcaggatgctgagttcctgtcttatatgtacaacatgaccgga
ctatcctcctgctattactaccaagagttcatagcggctgcaagtatcgcgtccggatca
gtgcacaacggtatggtttcattcccatcgaatgctgttgttttacccggtcatcaggga
gacgatttgggcggttcacagctgatgtattcccatttggcagaaagcaaactttcgccc
aacaagctgtcgcatatcctctactcccacaagcagatgaatcagcagttcgacaggaag
caaaaggaacgattactatccatacaggcaaagctgttttcctcctacgacaaggaacaa
caacctgcttatcgcactttcgagcagtatatgcagtgggaaaacatccctaagtatatg
ctcaacagccagcaatcatggcgattcttcggattagatacggtttgtatgcttctcgat
aaggaattgcttgactttgcttactctcttcctttcgaataccgctacggaaagcgtatc
tatgatgatatttgtcgtgaactgtatggcgagaaaggcatttctttttcggacgatttg
aacttgcatggcattatctcttctcctgtttaccgactcaaacgatctctaaagcctttg
cttcgaccatttataccccgtccttcgatttggaaaggcgatattatcggttttgaacgg
atcatgcaacctgtattacgacaggtagagcaggacggacgtttccacccgacatctata
aatgggttatccttctgctggtatctgcttcaaaacgaaaaattgattgaccgccctctg
cctctctga

DBGET integrated database retrieval system