KEGG   Porphyromonas gingivalis TDC60: PGTDC60_1751Help
Entry
PGTDC60_1751      CDS       T01516                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pgt  Porphyromonas gingivalis TDC60
Pathway
pgt00010  Glycolysis / Gluconeogenesis
pgt00051  Fructose and mannose metabolism
pgt01100  Metabolic pathways
pgt01110  Biosynthesis of secondary metabolites
pgt01120  Microbial metabolism in diverse environments
pgt01130  Biosynthesis of antibiotics
pgt01200  Carbon metabolism
pgt01230  Biosynthesis of amino acids
Module
pgt_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pgt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PGTDC60_1751 (tpiA)
   00051 Fructose and mannose metabolism
    PGTDC60_1751 (tpiA)
   00562 Inositol phosphate metabolism
    PGTDC60_1751 (tpiA)
Enzymes [BR:pgt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PGTDC60_1751 (tpiA)
Exosome [BR:pgt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PGTDC60_1751 (tpiA)
  Exosomal proteins of bladder cancer cells
   PGTDC60_1751 (tpiA)
  Exosomal proteins of melanoma cells
   PGTDC60_1751 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: BAK25900
Position
1818219..1818974
Genome map
AA seq 251 aa AA seqDB search
MRKNIVAGNWKMNKTLQEGLALAKELDAALKGRTINCDVIIGTPFIHLASIAAAIDTTRI
GVAAENCADKESGAYTGEVSAAMVASTGARYVIIGHSERRAYYHETSPILMEKVKLALSN
GLTPIFCVGEVLEEREAGKHFEVVARQVEEALFTLDQTDFAKLILAYEPVWAIGTGKTAT
ADQAQEMHAHIRKSIAAKYGKEVADGCPILYGGSCNAANAKELFSRPDVDGGLIGGASLS
VDKFLPIIEAF
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaacatcgtagcaggcaactggaaaatgaacaaaaccctccaagaggggctt
gcattggcaaaggagttggacgcagctttgaaagggcgtacgatcaactgtgacgtgatt
atcggaaccccattcatccatttggcaagtattgcggcagccatcgataccacacgtatc
ggagttgcagctgaaaactgtgccgataaggagtcgggtgcatataccggagaggtctct
gctgctatggtagccagtaccggtgctcggtatgtgattataggacatagcgaacgccgt
gcttactatcatgaaacatccccaatcctgatggagaaggtgaagttggctttgtccaat
ggcttgacccccattttctgtgttggcgaagtcttggaagagcgcgaagcaggcaagcac
ttcgaggtagtcgctcgtcaggtggaagaagccctgtttactttggatcagaccgacttt
gccaaattgatccttgcttacgagcctgtgtgggccatcggtacgggtaagacggctacg
gcagaccaagctcaagagatgcatgcacatattcgtaagagtatagccgctaaatatgga
aaagaggttgcggacggttgtcccattctctatggaggcagttgcaatgcagccaatgcc
aaagaactctttagccgtccggatgtagatggtgggcttatcggaggggcttctctctcg
gtagacaaattcttgcctatcatcgaagcattctga

DBGET integrated database retrieval system