KEGG   Meyerozyma guilliermondii: PGUG_00170Help
Entry
PGUG_00170        CDS       T01150                                 

Definition
(RefSeq) hypothetical protein
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
pgu  Meyerozyma guilliermondii
Brite
KEGG Orthology (KO) [BR:pgu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pgu01002]
    PGUG_00170
Enzymes [BR:pgu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     PGUG_00170
Peptidases and inhibitors [BR:pgu01002]
 Metallo peptidases
  Family M16: pitrilysin family
   PGUG_00170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16 Peptidase_M16_C
Motif
Other DBs
NCBI-GeneID: 5129529
NCBI-ProteinID: XP_001486793
UniProt: A5DA65
AA seq 922 aa AA seqDB search
MVLARYTKPIFLLGKRILSSASMPTLANFRVLADTTTIEKPLLDDRSYRLIKLQNDLHAL
VIHDPTTDKSAASLDVNVGAFADRKYEVSGLAHFCEHLLFMGTKKYPEENEYSSYLAKHS
GHSNAYTAAEHTNYYFEVGSGHFLGALDRFAQFFIAPLFSKSCKDREIRAVDSENKKNLQ
NDMWRLYQLEKLTSNPSHPYSGFSTGNFHTLHEEPIAQGKNVRDVLIDFHLNQYSSNLMS
LVVLGKEDLDTLSTWVSDLYSDIPNKSLSRPDYEGSVIFAPEQLGKLVQAKPIMDSNKLE
LNFMIPDDQEEYWESKPSGYFSHLLGHESSGSLLHYLKEKSWVNELSAGNMKVCQGSSLF
IIEFELTPAGLDHWQDIVVNVFEYISMVTTQEPQKWLWEEIKLMSEIDFKFRQKKGAAST
VSKMSSSLYKFWDNSFIPPTHLLSSSINRKFDPEAITKFGSYLFPENARITLISKKLEGL
DMKEKWYGTDYSLSTIDSSLLERAKLAAKNDRFHFPRPNPFIPKNFDVANKKLEKPLKHP
FLISDTSKFQVWFKQDDQFLVPKGTIEILLHLPDTNTDCKSSVFSMLMAELVADELTDIV
YYASLVGMSFKLSHWRDGLLVKVSGYNDKLPVLLETVLSKIKSFVPKKDRFETLKYKMIQ
DLTNFGYNVPYIQIGTHMSVIMNDKTYTHEDRVKVLQNNVDFEGFGLFCSKVWELGLFGE
AHIQGNFSYEKACGISSSIDSEFRNVRAIGASKNDIDNVVRLQSHILQPGETVRVEMDLM
DEKNVNSCIEYYIQIENSLSDIRKRTLTDLLETIMHEPCFNQLRTKEQLGYVVFSGVRLS
RTAIGFRILIQSERLTSYLEYRIEEFLKRFSVYVNELTAEQFDGFKQALKDKKLTKLKNL
SEEVSRFWEAIADGYYDFEAKG
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atggttctagcgaggtacacaaaacctatatttttgctgggaaaacgtatcttatcttct
gcctccatgcctacactcgccaacttccgtgtacttgctgacaccacaaccatagaaaaa
ccacttctagacgaccgttcataccgtctcataaagcttcaaaatgaccttcacgcgttg
gtaattcatgacccaactaccgacaagtctgctgcctcactcgatgtcaatgtaggtgcc
tttgcagacagaaaatatgaggtatctggccttgctcatttttgtgaacatctcttgttc
atgggcacaaaaaaatatcctgaagaaaatgaatattcaagctatttggcaaaacattct
ggccactcaaatgcctatactgctgctgagcataccaactactacttcgaggtgggctca
gggcattttctcggcgcattggatcggtttgctcagttctttattgcacctttgttcagt
aaatcgtgtaaagatcgtgagatccgagcagtagattcagaaaataagaagaacttgcaa
aacgacatgtggagactttaccagctagaaaaactgaccagcaatccatctcacccatat
tctggcttctctaccggaaatttccacactttacatgaagagccaatagctcaaggaaag
aacgttagagatgtcttaatcgactttcacctgaaccagtactcctccaatttgatgagc
ttggttgtgttgggtaaggaagacttagatacactttctacttgggtttctgatctttac
tctgatatacctaacaagtccctctcaagaccagattatgaaggctcggttatatttgct
cctgaacaattgggcaagcttgtgcaagccaagccgattatggatagcaacaagttggaa
ctcaactttatgatacctgacgatcaagaagaatactgggagagtaagccctcgggatac
ttctcgcacttgttgggccacgaaagctccggctcgcttttgcattatcttaaagaaaag
agttgggttaatgaactttctgctggaaatatgaaggtgtgccaaggaagctctttattt
atcattgagttcgaattgactcctgctgggttggaccattggcaagacattgtggtcaat
gtatttgagtatatctccatggtcactactcaagaaccgcaaaagtggttatgggaagaa
atcaagttgatgtcagaaattgacttcaaattccgccaaaagaaaggtgctgcttcaacg
gtttcgaaaatgagtagcagcttatacaaattttgggacaattcattcataccacccact
catcttttgagttcttcaatcaatcgcaaatttgatccagaggctataaccaaatttggc
tcatatctttttccagagaatgccagaatcaccttgatttcgaaaaagttggaaggactc
gacatgaaagaaaagtggtacggaactgactactccttatctactatagactcatcgttg
ttggagcgtgccaagctggctgcgaaaaacgacagattccatttcccacgtccgaatcct
ttcattcccaagaactttgatgttgcaaataaaaagctggagaagccattgaagcatcct
ttcttaatatcagatacctctaaattccaggtttggttcaaacaagatgatcagttctta
gttcccaagggtacaattgagattctcttgcatttgcctgacactaacactgattgcaag
tcatcggttttttcaatgttaatggcagaacttgtcgctgatgaattgactgatattgtt
tattatgcttccttggtgggcatgtctttcaaactcagccactggagagatggcttgttg
gtcaaggttagtgggtacaacgacaaattacctgtcttgttggaaacggttctttcaaag
atcaaatcattcgttcccaaaaaggatcgatttgagacattgaaatacaagatgattcag
gacttgactaatttcgggtataacgtcccctacattcaaattggaactcacatgtcagtg
ataatgaacgataaaacgtacactcatgaagatagagtaaaagttttgcaaaataacgtt
gattttgaggggttcggcttgttttgttccaaggtttgggagctgggattgttcggtgaa
gcccacattcagggtaacttcagctatgaaaaggcatgcggaatcagctcgagcattgat
tccgaattcaggaacgttagagctattggagcttcgaaaaatgatattgacaatgtcgtt
aggctccagtcacacatactccaacctggtgaaacggtaagagtcgaaatggacttgatg
gatgagaagaatgtgaactcttgtattgagtattacattcaaatagagaactctttgagt
gatattcggaaaagaaccctcaccgatttgcttgagacgatcatgcacgaaccttgtttc
aaccaactcagaactaaggaacaacttggttatgttgtattctcgggtgtgcgtctctca
cgcacggctatcggtttcaggatcttgatccagtcagagcgtctgacctcttacttggaa
tacagaatcgaggaatttttgaaacgtttctcggtatatgtgaacgagcttactgccgaa
caattcgatggtttcaagcaagcccttaaggataagaagttgacgaagttgaagaatttg
agcgaagaagtatcgcgtttctgggaggcgatagctgatggatattacgattttgaagcc
aagggctaa

DBGET integrated database retrieval system