KEGG   Meyerozyma guilliermondii: PGUG_00645Help
Entry
PGUG_00645        CDS       T01150                                 

Definition
(RefSeq) hypothetical protein
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
pgu  Meyerozyma guilliermondii
Pathway
pgu00071  Fatty acid degradation
pgu00410  beta-Alanine metabolism
pgu00592  alpha-Linolenic acid metabolism
pgu00640  Propanoate metabolism
pgu01040  Biosynthesis of unsaturated fatty acids
pgu01100  Metabolic pathways
pgu01110  Biosynthesis of secondary metabolites
pgu01200  Carbon metabolism
pgu01212  Fatty acid metabolism
pgu04146  Peroxisome
Module
pgu_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    PGUG_00645
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PGUG_00645
   00592 alpha-Linolenic acid metabolism
    PGUG_00645
   01040 Biosynthesis of unsaturated fatty acids
    PGUG_00645
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PGUG_00645
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    PGUG_00645
Enzymes [BR:pgu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     PGUG_00645
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_ox_N Acyl-CoA_dh_1
Motif
Other DBs
NCBI-GeneID: 5128851
NCBI-ProteinID: XP_001487268
UniProt: A5DBJ0
AA seq 703 aa AA seqDB search
MSATNSVSFAPPPDPASLLRRERENASIDPLAMHRFIEGSAEKSSQILRLYSSLERDPVM
AASYRDYELDLEEQRELTTMRINRMTRYIETDTASDFARRLNLVTIYDPSMGIRISVNLG
LFLNCIRGNGTSDQYEYWAKHHESAIMKQMYGCFGMTELGHGSNVAGCETTATFDKEKDE
FVINTPHIGATKWWIGGAAHSATHSVVYARLLVDGKDYGVKTFVVPLRDSNHDLLPGISV
GDIGAKMGREGVDNGWIQYSNVRIPRFFMLQKWCRVSAEGKVTLPPLEQLSYISLLGGRV
MMAVDSYRMSARFITVALRYAVGRRQFKSQSTRDGKETQLLDYPLHQKRLLPYLALAYAM
AVGSNKLEIQHGEIVANLEKAVANNDKKGIEQSIALTKSLFVDSGSLKSTYTWLTADCIN
EARQLCGGLGYSSYNGFGKTYGDWVVQCTWEGDNNVLGMSAGKTIINNLKLAVQKNKLIS
GSLSYLSRGRQGMSDKYVLGQDSDVESPEKVLEALETLIIRVAGTALNTLSDNGNDWDSI
SHTRVLLSKLQCHRYTLFTFIERVAENKDTQLEEALVLLLKLYYQVNILQAFAGEFLTYN
VMLGQVQASVSLRAIPSTLTALRPHAIILSDSFQQPDMILNSAIGRYNGDIYENYYGVVK
AANPPIRDKAPYSAAFQAMLNRPDLQTRERFEKWGAAKMKLSK
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgtcggctacaaacagtgtgagctttgctccacctccagatcctgccagtcttcttcgt
cgtgaaagagaaaatgcatctattgatccattggccatgcacaggttcatcgagggaagc
gctgaaaaatcgagtcaaatcttaaggttgtatagttcattggaaagagacccggtaatg
gctgcgagttaccgtgactacgaattggaccttgaggaacagcgggagctcactaccatg
cgtatcaatagaatgacaaggtacattgagacggatacggcgtctgattttgcacgaaga
ttgaaccttgtgacgatttatgatccttcgatgggaattcgtatcagtgttaatcttgga
ttatttctcaactgtattagaggcaatggtacaagtgaccagtacgagtattgggcgaaa
catcatgaatctgccattatgaaacaaatgtacggttgctttggaatgacagaattgggc
catggttccaatgttgctggctgcgaaaccaccgctacttttgataaggaaaaggatgag
tttgttatcaatactccacacattggagccacaaaatggtggataggtggtgctgcgcat
tctgccactcattcggtggtatatgctcgtttgcttgtcgatggtaaagattatggagtc
aagacttttgttgttcctctccgtgactcgaaccacgatttgcttcccggtattagtgtg
ggagatataggtgccaaaatgggccgtgaaggtgtggataatgggtggatccagtactcc
aatgtgagaattcctcggttctttatgcttcaaaaatggtgccgagtttctgctgagggt
aaggttactcttccaccattggagcaattgtcttatatctcacttttaggaggcagagtg
atgatggctgtggactcgtatcgtatgagtgcccggttcatcactgtggctctcagatat
gccgtgggaagacgtcaatttaaaagtcaaagtactcgcgatggtaaggaaacccagctt
cttgattacccacttcatcagaaacgactcttaccataccttgcattggcttatgccatg
gcggtgggttctaacaagttggaaattcaacatggagaaattgttgcaaaccttgaaaag
gccgtagccaacaatgataaaaaaggcattgagcagtcaattgccctaacaaaatcactc
tttgttgactctgggtctctcaaatctacctatacctggctcaccgccgactgtataaac
gaggcaagacagctgtgtggtggacttggatactcatcgtacaatggttttggtaaaacc
tatggtgactgggtggttcaatgtacttgggaaggtgacaataacgtattgggaatgtca
gctggtaagactattatcaacaacttgaagcttgcagttcaaaagaataagctgataagt
ggttctttatcgtacttgtctcgaggacgtcaaggtatgagtgacaagtacgttttgggt
caagattccgatgtggaaagtcctgaaaaagtgttggaagctttggaaacgttgattatt
cgtgttgctggaactgccttgaacacattgagtgacaatggcaatgactgggatagtatt
agtcacactcgtgttttgctttccaagttgcaatgccatcgctatactcttttcacgttc
attgaacgtgtagcggaaaacaaggatacccaattggaagaagctttggttcttttgctc
aaattgtactaccaagtcaacatcttgcaagcatttgctggagaatttctcacctataat
gtcatgctgggtcaagtgcaagctagcgtaagcttgagagccattccttccactttaaca
gcattgcgtcctcatgccattatattgagtgactcgttccagcagcccgatatgatcttg
aattcggcaattggtcgctataatggtgatatttatgaaaactactatggagtagttaag
gctgcaaatccacctatccgtgacaaagccccatactctgcggcgttccaggcgatgttg
aaccgacccgatttgcagacgagggagcggtttgaaaagtggggagccgccaagatgaag
ttgtcaaagtag

DBGET integrated database retrieval system