KEGG   Meyerozyma guilliermondii: PGUG_01489Help
Entry
PGUG_01489        CDS       T01150                                 

Definition
(RefSeq) hypothetical protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pgu  Meyerozyma guilliermondii
Pathway
pgu00071  Fatty acid degradation
pgu00072  Synthesis and degradation of ketone bodies
pgu00280  Valine, leucine and isoleucine degradation
pgu00310  Lysine degradation
pgu00380  Tryptophan metabolism
pgu00620  Pyruvate metabolism
pgu00630  Glyoxylate and dicarboxylate metabolism
pgu00640  Propanoate metabolism
pgu00650  Butanoate metabolism
pgu00900  Terpenoid backbone biosynthesis
pgu01100  Metabolic pathways
pgu01110  Biosynthesis of secondary metabolites
pgu01130  Biosynthesis of antibiotics
pgu01200  Carbon metabolism
pgu01212  Fatty acid metabolism
Module
pgu_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:pgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PGUG_01489
   00630 Glyoxylate and dicarboxylate metabolism
    PGUG_01489
   00640 Propanoate metabolism
    PGUG_01489
   00650 Butanoate metabolism
    PGUG_01489
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PGUG_01489
   00072 Synthesis and degradation of ketone bodies
    PGUG_01489
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PGUG_01489
   00310 Lysine degradation
    PGUG_01489
   00380 Tryptophan metabolism
    PGUG_01489
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PGUG_01489
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pgu04147]
    PGUG_01489
Enzymes [BR:pgu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PGUG_01489
Exosome [BR:pgu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PGUG_01489
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 5127566
NCBI-ProteinID: XP_001485818
UniProt: A5DDY8
AA seq 400 aa AA seqDB search
MSVYIVSTARTPIGSFQGGLSSLTYTDLGSHAVKAALEKVPQIKPEEVDEILFGGVLQAN
VGQAPARQVALKAGLPESIVATTINKVCASGMKSIILGAQSILTGSADIVITGGAESMSN
TPYYLPSARGGARYGDSTMVDGVQKDGLLDVYSQKLMGVAAEKCALDYSVTREDQDAFAT
SSYSKAASAQKSGKFDLELAPITIKGVRGKPDVVVSEDEEVKNFNEARLKSARTVFQKEN
GTVTAPNASKLNDGGAAVILVSESKLKELKLTPLARISGWGEAARAPLDFTVAPSLAIPK
ALKHAKLSQLDIDFFELNEAFSVVGIANAKICDIPQEKLNVYGGAVALGHPLGCSGARIV
VTLLSVLNQEGGKIGLAAVCNGGGGASAVVIEKLDKDYKL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtctacattgtttccaccgcacgtactcccattgggtccttccagggcggatta
tcgtccttgacttacaccgacttgggaagccacgccgtcaaagctgcacttgaaaaagtg
ccacaaatcaagccagaagaggttgatgaaatcttgtttggaggagttttacaggccaat
gtgggccaggcgcccgcacgccaggtcgctctcaaggctgggttacctgaatccatcgtt
gctaccaccattaataaggtttgtgcttcaggaatgaagtctatcatcttgggagctcag
tcgattttgacaggaagtgctgatatcgttattactggaggtgccgaatccatgtctaac
acaccatactacttgccttctgccagaggcggagctcgctatggagattccaccatggtg
gacggagtccagaaagatggattgttggacgtctactcgcaaaaattgatgggtgttgca
gccgaaaaatgtgctctggattacagtgtgaccagagaagaccaggatgcttttgccacc
tcgtcttactccaaggccgccagtgcccaaaaatccggaaaatttgacctggaattggcc
ccaattaccatcaaaggtgttcgtggaaaaccagatgtggtggtgtcggaggacgaagag
gtgaaaaacttcaacgaggcgagactcaagtcagccagaaccgtgttccagaaggaaaac
ggtactgtgaccgcccccaatgcctccaagttgaacgatggtggagctgccgtgatcttg
gtttccgaatccaagttgaaggaattgaagttgactcccttggccagaatctccggctgg
ggtgaggctgctcgtgctcctttggacttcaccgtggctccatcgttggccatcccaaag
gctttgaagcatgccaagttatctcaactggacattgacttctttgagttgaacgaggct
ttctctgttgttggaattgccaatgccaagatctgtgatattccacaagaaaaactcaat
gtctacggaggagccgtcgccttgggccacccattgggatgctcgggtgccagaattgtc
gtcaccttgttgtcggtgttgaaccaagaaggaggaaagattggtttggctgctgtgtgt
aacggaggtggtggagcatctgccgtcgtcatagagaagctcgacaaggattacaagctc
tag

DBGET integrated database retrieval system