KEGG   Meyerozyma guilliermondii: PGUG_01727Help
Entry
PGUG_01727        CDS       T01150                                 

Definition
(RefSeq) hypothetical protein
  KO
K12737  peptidyl-prolyl cis-trans isomerase SDCCAG10 [EC:5.2.1.8]
Organism
pgu  Meyerozyma guilliermondii
Brite
KEGG Orthology (KO) [BR:pgu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pgu03041]
    PGUG_01727
   03110 Chaperones and folding catalysts [BR:pgu03110]
    PGUG_01727
Enzymes [BR:pgu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     PGUG_01727
Spliceosome [BR:pgu03041]
 Complex C
  Other components
   PPlases
    PGUG_01727
Chaperones and folding catalysts [BR:pgu03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    PGUG_01727
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase DUF656
Motif
Other DBs
NCBI-GeneID: 5128385
NCBI-ProteinID: XP_001486056
UniProt: A5DEM6
AA seq 384 aa AA seqDB search
MGQCHSAGHISHLNTYDHHNLQLFMLEPQPATTVVFKTSKGPLELQLWTKEIVCARKFVE
KCSTGFSGGLTFSKAVHDNVIEAQASTIEYDMDLESHPRINFSQRGYVGALKDEKSGKFS
ADGIFITMKEFPTFHKKYTVIGKVTTDTFFTVLKITEGENEEGKLVYPVSATPISIDGDE
TKVQVIEPSLVRSENFQQTAKKTKRRVALDYDEQPDIEVKRVKMKLAYELLGERKKSEEK
SGQKSEVKKEEGELKSEEKRNEQNREVKNGEKTQNEDKNAEKVNENDDKDKNENDKTKEE
KYNDRETTKINDAEPLAEPSELSKNKDIRSQKEITFLQEPKSRDQYKQLSSTSKRRRSFA
YNPALDFDSSDEKPPTNLKTHVYK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgggccagtgccattctgcaggacatatctcgcatctcaacacctacgatcaccataac
ttgcaactatttatgctagagccacagcccgcaaccacggtggttttcaagacgtccaaa
gggccacttgagttgcaattgtggacgaaggagatagtatgtgctcgaaaattcgttgaa
aaatgctccacgggattttcaggtggtttaacgttttccaaggctgtccacgataatgtc
attgaggctcaagccagtacaattgagtacgatatggaccttgagagtcacccaaggatc
aattttagccagagagggtacgtaggagcactcaaggacgaaaagagtgggaagttcagt
gctgatgggatcttcataacgatgaaagaatttcctacttttcacaaaaaatatactgtg
ataggaaaggtcaccacagacacattttttactgttctcaagataacagagggcgaaaat
gaagaaggaaagcttgtttatcctgttagtgctacgcctataagcattgatggagatgaa
actaaagttcaagtcatagaaccaagtctggttcggtctgaaaattttcaacaaactgct
aaaaagacaaagcggagggttgcgttggactatgacgagcaaccagacatcgaggtgaag
agggtgaagatgaaactggcgtacgaattgttgggggagaggaaaaaaagtgaagaaaaa
agtggacaaaagagtgaagtaaagaaggaagaaggtgaactgaagagtgaagaaaagaga
aatgaacaaaaccgtgaagtaaagaatggtgaaaagacacagaatgaggacaagaatgct
gaaaaagttaatgagaacgacgacaaagacaagaatgaaaatgacaaaacgaaagaagag
aagtataatgatagagaaacaacaaaaatcaatgatgctgaaccgctagcagagccatct
gagttatcaaaaaacaaagatatacggagtcagaaagaaatcactttcttacaagagcca
aagagcagagatcagtacaaacagctttccagtacttcaaaaagacgacgaagctttgcc
tataatccagcattggatttcgactcttcagatgaaaaaccgcctactaatttgaagact
catgtatacaagtga

DBGET integrated database retrieval system