KEGG   Meyerozyma guilliermondii: PGUG_02173Help
Entry
PGUG_02173        CDS       T01150                                 

Definition
(RefSeq) hypothetical protein
  KO
K00668  fatty acid synthase subunit beta, fungi type [EC:2.3.1.86]
Organism
pgu  Meyerozyma guilliermondii
Pathway
pgu00061  Fatty acid biosynthesis
pgu01100  Metabolic pathways
pgu01212  Fatty acid metabolism
Module
pgu_M00082  Fatty acid biosynthesis, initiation
pgu_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pgu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PGUG_02173
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pgu01004]
    PGUG_02173
Enzymes [BR:pgu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.86  fatty-acyl-CoA synthase system
     PGUG_02173
Lipid biosynthesis proteins [BR:pgu01004]
 Fatty acid synthase
  Yeast type
   PGUG_02173
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF1729 Acyl_transf_1 SAT FAS_meander MaoC_dehydratas FAS_N MaoC_dehydrat_N Tic110 NMO
Motif
Other DBs
NCBI-GeneID: 5128355
NCBI-ProteinID: XP_001486502
UniProt: A5DFX2
AA seq 2074 aa AA seqDB search
MATSLRPFSLTHGAIEHTCLVPTNLFFSFSQLKEQFVKVLPEATEGNAGDNEPASPAELF
AKFLGYTASLVDPASPGQFDQVLKLSLQDFESRFLSNNSDVHSLAAQLLADDVNYPTTTA
KVKDVITNYYTAVINSNTSIPKSESDLLRHSINNKSNTSAQKAEIIALFGGQGNTDEYFE
ELRDLYRMYNGLVKELLDKVATRLNKLVKSTENVDKIYTQGFDVLKWLLKPEQTPDQDYL
LSVPVSCPLICVIQLCHYTVTCKTLGLTPGDLRQYLSGTTGHSQGLVTSLALASSDSWES
FYDNALKAVSILFFIGTRSLMAYPRTTLPPTMLQDSLENGEGRPSPMLSVRDLSIEEVES
FIGQTNKHLPQEKHVGISLINGARNLVVSGPPESLYGLNLTLRSKKAPAGLEQARVPFSE
RKLKFSNRFLPIFSPFHSHLLADATEVILDDLEANGVSLKKSDLQIPVYDTFSGQNLQDF
DESSGETVVARVIRCITELKVNWESATNFKSTHLLDFGPGGVSGLGVLTHRNKDGTGSRI
IIAGTLETNSPDDEYGFKQEIFCKAENSIKWAPNWLKEFKPKLTKTKNGKVFVDTKFSRL
LGRPPLMVPGMTPTTVNPDIVAATINAGYHIEIAGGGYFSAGHMEGALKQVEAKIAPGSG
IGINLIYVNPRMLQWGIPLIKELREKGFPIQSMSIGAGVPSLEVATEYIETLGLTHLGLK
PGSIDAISQCITIAKAHPEFPIVVQWTGGRGGGHHSYEDFHQPILQMYSKIRKCSNIILV
AGSGFGSDEDTYPYLTGSWSEHFNYPPMPYDGVLFGSRMMTAKEAHTSLDAKKAIAACTG
VPDGEWEKSYKKPTGGIITVRSEMGEPIHKIATRGVLFWKEMDDSIFNLPKNKMLEALTK
KKDYIISKLNKDYQKPWFGVNAEGVCDLQDMTYQEVANRLVELMYIKKSKRWIDISLRNF
YGDILRRIEERFTSEPSKKSVIQNYAQLQEDPQAFTDKFFEYYPMAKNQLINEEDCDYFL
ICCQRPTQKPAPFVPVLDERFEFFFKKDSLWQSEDLEAVVDEDVQRTCILHGPVAAQFTT
KVNEPVKEILDSIHEGHIRRLIADDYANDESKIPVVEYFGGKNAVPYKPIPGVVREVSGS
KITFKVTSPITSKNDWLQAIAGEKLNWLHAFITTDRVVQGLNHVKNSFHDILIPPVNLVV
EIENESSDKIKLTLLESIRDDLKPVVEIKLVENGLIQSSLIEHRTADGKPAYLNFLYKFN
PRDGFAPISEVMDGRNDRIKNFYWQLWFGSQISPDFNIDVEKIIPGDKTTISGKLISEFT
HAIGNKCDAFVSRPGKPTLAPMDFAIVIGWKAIMKAIFPKTIDGDLLRLVHMSNGYKMIP
GASPLQKDDVVSSSAEIKAVVNQPSGKMVEVVGTITRDGKPVMEVTSQFLYRGEYVDFEN
TFQKTTETPMQVSYKSAKDVAILTSKEWFHLEKEVNLMGQDLTFRCESVYKFKSANVYSS
IRTTGQVYLELPSKEVIQIGSVDYEAGKSYGNPVTDYLSRNGNSIEQAVKFENAIPISSG
EELTSKAPSTNEPYAKVSGDYNPIHVSRVFASYANLPGTITHGMYSSASIRALVEEWAAN
NIASRVRAFKSDFVGMVLPNDTLQTTLEHIGMINGRKIIKVETRNVDADMTVLIGEAEIE
QPITTYVFTGQGSQEQGMGMDLYNSSAVAREVWDRADRHFVDNYGFSILNIVKNNPNELT
IHFGGPKGRKIRDNYIGMMFETIAEDGSIKSEKIFKDIDHNTTSHTFVSPTGLLSATQFT
QPALTLMEKASYEDIKSKGLVPENIMFAGHSLGEYSALSSLANVMPIESLVDVVFYRGMT
MQVAVPRDEFGRSNYGMCAVNPSRIDPTFNDAALRFVVEEVASTTGWLLEIVNYNVENTQ
YVTAGDLRALDTLTNVLNVLKLNKINIVKLQETLSIEEVKKHLKDIIDEVSAKSSAKPQP
IDLERGFAVIPLKGISVPFHSSYLMSGVKPFQRFLCKKIPKSSVKPNDLINKYIPNLTAK
PFEITKEYFQEVYELTKSQKIKAIIDNWEQYEKA
NT seq 6225 nt NT seq  +upstreamnt  +downstreamnt
atggccacatcgcttcgtcctttttcgttaactcacggagctatagaacatacctgtttg
gtacctacaaacctttttttcagcttttcccagcttaaagagcagtttgtaaaggtgctt
cccgaagctactgagggtaatgccggcgacaatgaaccagcatctcctgcggagttattc
gccaagtttttgggttacactgcctccttggtggatcccgcatcccctggtcaatttgat
caagtcttaaaattgtcacttcaggattttgagtcgagattcttgtccaataattctgat
gtgcattccttggctgcccaattgcttgcagatgacgtcaattacccaactaccaccgcc
aaagtgaaggatgtgatcaccaactattatactgcagtgatcaattccaatacttctatc
ccaaagtctgagtccgacttgttgagacactccattaataacaaatccaacacctccgct
caaaaggcagagatcatcgctttgtttggtggacagggaaataccgatgagtatttcgag
gagttgagagacttgtaccgtatgtacaacggattggtcaaggaattgctcgacaaagtc
gctaccagattgaacaaattggtcaaatccaccgagaatgtcgacaaaatctatacccaa
ggtttcgatgttttaaaatggttgctgaaaccagagcaaactcctgatcaagattacttg
ttgtctgtcccagtgtcgtgtccattgatctgtgtcattcagttgtgtcactacacggtg
acatgtaagactttgggtttgaccccaggagaccttagacaatacttgtcaggtaccact
ggtcactcgcaaggtttggttacttcgttggccttggcttcctccgattcttgggaatca
ttctatgataatgccttgaaggccgtatctatattgttcttcattggaacgagatcgttg
atggcctacccaagaactaccttaccaccaacaatgttgcaagactctcttgaaaacggc
gaaggaagaccatctcctatgttgtctgttagagacttgtctatcgaagaagtcgaatct
ttcattggtcaaaccaacaagcacttgcctcaagagaagcatgttggtatctccttgatc
aatggtgctagaaatctcgtggtgtccggtcccccagagtctttgtatggattgaacttg
actttgagatcgaagaaggctccagcaggtttggaacaagctagagtgccattttctgaa
agaaaattgaaattttccaacagattcttgccaatcttttctccattccactctcatctt
ttggctgatgcaactgaggttattttggatgacttggaagctaacggtgtctcgttgaag
aagagcgatttgcagattcctgtctatgatacattcagtggtcaaaatcttcaagacttt
gatgagtcctctggtgaaaccgttgtggctcgtgtgatcagatgcatcaccgaattgaag
gtcaactgggaaagtgccaccaactttaagtctacccacttgttagactttggtcctggt
ggtgtttctggattgggtgttttgacccaccgtaacaaagacggaaccggatccagaatt
atcattgcaggtactttggagaccaactcgcccgatgatgaatacggattcaagcaagaa
attttctgcaaagctgagaactctatcaaatgggctcccaactggttgaaggaattcaag
ccaaagttgaccaagaccaagaacggtaaggtcttcgtcgataccaaattctccagactt
ttaggaagacctcctctcatggttccaggtatgactcccactaccgtcaatcctgatatc
gtggctgctacgatcaatgctggttaccacattgagattgcaggtggaggttactttagt
gctggtcatatggaaggcgctctcaaacaggttgaagcaaagattgctccaggctctggt
attggtatcaacttgatttacgtaaaccctagaatgcttcaatggggtattccattgatc
aaggaattgagagagaaaggcttcccaattcaatccatgtctattggtgctggtgttcct
tctttggaagttgctacagagtacattgagacgttgggattgactcatttgggattgaag
ccaggatccattgacgcaatctcccaatgtatcactattgctaaggctcatcctgaattc
cctatcgttgtgcaatggactggtggtagaggtggtggccatcactcttatgaggatttc
catcaacctatcttgcaaatgtactccaagattagaaaatgttccaacattatcttggtc
gccggctcaggtttcggttccgacgaggatacttatccatacttgactggttcttggtcc
gaacatttcaactacccaccaatgccttatgatggtgttttgtttggttctagaatgatg
accgctaaggaagctcatacttctttggacgccaagaaggctatcgctgcctgtaccggt
gttccagatggtgaatgggagaagtcctacaagaagccaactggaggtatcatcactgtt
agatcggaaatgggcgaaccaatccacaagattgccaccaggggtgttttgttctggaag
gagatggatgactccatcttcaatcttccaaagaacaaaatgcttgaagctttgacaaag
aagaaagactatatcatcagcaagttgaacaaagactaccaaaagccatggtttggtgtg
aatgcggagggtgtttgtgatttgcaagacatgacataccaggaagtcgccaacagattg
gttgagttgatgtacatcaaaaagtctaagagatggattgatatttcgttgagaaacttc
tatggagacatcttgagacgtattgaggagcgtttcacctctgagcccagcaaaaagtca
gttatccaaaactacgcacagcttcaagaagatcctcaagctttcaccgacaagttcttt
gagtactacccaatggccaagaaccaattgatcaatgaagaggactgtgattacttcttg
atttgttgccagcgtcctactcaaaagcctgcaccatttgtgccagttcttgatgaaaga
ttcgagtttttcttcaagaaggattctttgtggcaatctgaagatttggaagctgttgtg
gatgaagacgttcaacgtacttgtattttgcatggccctgttgctgctcagttcaccacc
aaggttaatgaacctgtgaaggagattttggattcgattcatgagggacacattagaagg
ttgattgcggacgattacgccaacgatgagtccaagattcctgttgtggagtactttggt
ggaaagaatgctgttccttacaaaccaattccaggagttgtcagagaggtttccggatcg
aagatcaccttcaaggtgactagtccaattaccagcaaaaatgattggttgcaagctatt
gctggtgagaaattgaactggcttcacgcctttatcacaaccgacagggttgttcagggc
ctgaaccatgtcaagaactcattccacgatatcttgattcctccagtgaacctggtggtt
gagattgaaaatgagtcgagtgacaagatcaagctcaccctcctcgagtctatccgtgac
gacttgaagcctgttgtcgaaatcaagcttgttgagaatggtcttattcaaagctctttg
attgaacacagaactgccgatggaaagcccgcttacttgaacttcctctacaagttcaat
ccacgcgatggttttgctcctatctcggaggttatggatggtcgcaacgatagaatcaag
aacttctactggcaattgtggtttggctcgcagattagtcccgatttcaacattgatgtt
gagaagatcatccctggtgacaagaccactatttccggcaagctcatctcggagttcacc
catgctatcggaaacaagtgtgatgcctttgtatccagaccaggcaaacctactttggct
ccaatggattttgcaattgttattggatggaaggctatcatgaaagcgattttccccaag
acaatcgatggtgatttgttgcgtttggttcacatgtccaatggttacaagatgattcca
ggtgcttctcctttgcagaaggacgacgtggtatcgtccagtgccgagatcaaggctgtc
gtcaatcagccatctggaaagatggtggaagtcgttggtactatcactagagatggtaag
ccagtgatggaagtcacttcccagttcttgtaccgtggtgagtatgttgattttgagaac
actttccagaagaccaccgagactccaatgcaagtctcttacaagtctgctaaggacgtt
gccattcttacttctaaggagtggttccacttggagaaggaggtcaatttgatgggtcaa
gatttgactttccgttgtgaatctgtctacaagttcaaatccgcaaatgtgtactcttca
attcgtacaactggtcaagtgtacttggaacttccctcaaaggaggttattcaaattggt
tcagtcgattatgaagccggtaagtcttacggtaacccagttaccgactatttgtcgaga
aacggaaactcaatcgaacaggccgtcaagttcgagaatgctatcccaatttcctccggt
gaagagttgacctcaaaggctccaagtaccaatgaaccttatgctaaggtatctggtgat
tacaatccaatccatgtttcaagagtgtttgcctcctacgccaatttgcctggaactatc
actcacggtatgtactcctcggcttctatcagagctttggtcgaagagtgggctgctaat
aacattgcctccagagttagagctttcaagagtgactttgtcggaatggtccttcctaac
gacaccttgcaaactactttggaacatatcggtatgatcaatggtcgtaagatcatcaag
gttgagacaagaaatgttgatgctgatatgactgtcttgatcggagaggctgaaattgaa
caaccaattaccacttacgttttcacaggacaaggatcccaagagcaaggtatgggtatg
gacttgtacaactcttcagctgttgccagagaagtatgggacagagctgatcgtcacttt
gttgataactatggattctccattctcaacattgtgaagaataaccctaacgagttgaca
attcactttggtggtccaaagggtagaaagatcagagacaactacattggaatgatgttc
gagaccattgctgaagacgggtcaattaaatctgagaagattttcaaagacattgaccac
aacacaacctcgcatacttttgtttcgccaactggtttgttgtctgctacacagttcacc
caacctgctttgaccttgatggagaaggcttcttatgaagatatcaagtcgaagggattg
gtaccagaaaacatcatgtttgctggtcactccttgggtgaatattctgctttgtcctct
ttggcaaatgtcatgcctattgagtcattggtggatgttgtgttctaccgtggtatgacc
atgcaagtcgcagttccaagagacgaatttggaagatccaactatggtatgtgtgctgtg
aatccttccagaattgaccccactttcaatgatgctgcgttgcgtttcgttgttgaagaa
gttgcttctactactggatggctcttggaaattgtgaattacaacgtcgagaacacccaa
tatgtcactgctggtgacttgagagccttggataccttgacaaacgtgctcaatgtcttg
aaattgaacaagatcaacatcgtcaagttgcaagaaaccttgagtattgaagaagtcaag
aaacacttgaaggatatcattgacgaggtttcagctaaatccagtgcaaagcctcagcca
attgacttggaaagagggttcgctgtcatcccattgaagggtatctctgttcctttccac
tcatcctacttgatgtctggagtgaagccattccaaagattcttgtgcaagaagattccc
aaatcttctgtcaagcctaatgacttgatcaacaagtacattcctaacttgaccgctaaa
ccatttgagatcaccaaggagtacttccaagaagtttacgaattgactaaatcccaaaag
atcaaggctatcatcgataactgggagcagtatgagaaagcctga

KEGG   Meyerozyma guilliermondii: PGUG_04086Help
Entry
PGUG_04086        CDS       T01150                                 

Definition
(RefSeq) hypothetical protein
  KO
K00645  [acyl-carrier-protein] S-malonyltransferase [EC:2.3.1.39]
Organism
pgu  Meyerozyma guilliermondii
Pathway
pgu00061  Fatty acid biosynthesis
pgu01100  Metabolic pathways
pgu01110  Biosynthesis of secondary metabolites
pgu01130  Biosynthesis of antibiotics
pgu01212  Fatty acid metabolism
Module
pgu_M00082  Fatty acid biosynthesis, initiation
pgu_M00874  Fatty acid biosynthesis in mitochondria, fungi
Brite
KEGG Orthology (KO) [BR:pgu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PGUG_04086
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    PGUG_04086
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pgu01004]
    PGUG_04086
Enzymes [BR:pgu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.39  [acyl-carrier-protein] S-malonyltransferase
     PGUG_04086
Lipid biosynthesis proteins [BR:pgu01004]
 Fatty acid synthase
  Component type
   PGUG_04086
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl_transf_1 SAT baeRF_family2
Motif
Other DBs
NCBI-GeneID: 5125422
NCBI-ProteinID: XP_001483357
UniProt: A5DLD5
AA seq 315 aa AA seqDB search
MSISTVFSNGTKAVKKSALSCPGQGLDLLAAFAGFHKHKNLFKRFLDEVDDALGENLSLS
LFDKNPQLDLMRTYYAQPAILTATVCIHEYIRRVHGVDLIRQPEVEYILGHSLGEYSALA
VSGMLELGTAVQLVRKRAQLMEDLVLNSKNYEMKALMFRAPFFEKVLKHCDDNQILANVN
TCQQIVVAGEKQKIQAVLDQLPKRTIAKITALPVKIPFHNEKLRPMEAKLLKWIEHKEIK
LPIKPFILNLTGKISLDPQHILSSILRTNSCPVQWVKSMETLKAEGINTVYALGPGEILS
GLNSKFMESISLSEP
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgtctatttctacggtgttcagtaatggcaccaaagccgtcaaaaaatctgcgttatcg
tgtcctgggcaaggcttagacttgctggcggcatttgctggcttccacaaacacaaaaat
ctctttaaacgattcttggatgaggttgacgatgccttgggtgaaaacttgtcactgagt
cttttcgataaaaatccccaattggacttgatgaggacatactatgcccagccagccata
ctcacagccacggtatgcatccacgagtacattcgccgagttcatggcgtagatctcatt
cgtcagccagaagtggaatacattcttggtcattctttgggcgaatattccgctttggct
gtttctggaatgcttgagcttggtacagcggtacagctagttcgcaagagagcacaattg
atggaagatttggtgcttaacagcaaaaattatgaaatgaaagctctcatgtttcgagca
ccattttttgaaaaagtgctaaaacactgcgacgacaaccaaatcttggcaaacgttaac
acttgccagcagatagtggttgctggagaaaaacaaaaaatacaggcggttttggaccaa
ttgccgaaaagaacaattgcaaaaattacagctttaccggtaaaaattcccttccataat
gaaaagcttcgtccaatggaagcaaaattgctgaaatggatagaacataaagagatcaaa
ctgccaattaaacctttcatactaaacttgacaggaaaaatttcgctggatccgcagcat
atactatcgtctattctacgcacaaactcttgcccagttcagtgggtcaagtcaatggag
actctcaaagcagagggtatcaatacagtctatgctttgggacccggagagatactaagt
ggactcaattcgaaattcatggagagcatttctctttctgagccataa

DBGET integrated database retrieval system