KEGG   Meyerozyma guilliermondii: PGUG_02787Help
Entry
PGUG_02787        CDS       T01150                                 

Definition
(RefSeq) hypothetical protein
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
pgu  Meyerozyma guilliermondii
Pathway
pgu00020  Citrate cycle (TCA cycle)
pgu00640  Propanoate metabolism
pgu01100  Metabolic pathways
pgu01110  Biosynthesis of secondary metabolites
pgu01130  Biosynthesis of antibiotics
pgu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PGUG_02787
   00640 Propanoate metabolism
    PGUG_02787
Enzymes [BR:pgu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     PGUG_02787
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PGUG_02787
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 5127334
NCBI-ProteinID: XP_001485058
UniProt: A5DHN6
AA seq 404 aa AA seqDB search
MHPSATACNHGFAMWSRRLSHIERESDICNQNAIRTHLSAPWFCNQGAARPRNFVPLPGP
PCPGFARTRPVRKMPEFQNTLVIMKSIRSLSTSAPLRNYASTIKNLKVNLDTKVIYQGFT
GRQGTFHAEQAIAYGTKIVGGTNPKKAGSTHLDRPVFANVSDAIKETGANATAIFVPPSI
AAAAIEEAIEAEIELAVAITEGIPQHDMVRIAQMLKTQSKTRLVGPNCPGLIAPDQCKIG
IMPSHIHQRGKVGVISRSGTLTYEAVAQTTGVGLGQSLVIGMGGDPFPGTNFIDALTLFL
EDKETEGIILIGEIGGTAEEEASEFLKQHNLTRPDGPKPVVSFIAGVSAPPGRRMGHAGA
IISGGKGDAKSKIAALESAGVVVERSPARLGNSLLEEFKNKGLL
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcacccatctgcaacagcatgcaaccatggttttgcgatgtggagcagacggctttct
catatagaaagagagtccgacatttgcaaccagaacgcaatcagaacgcatctatctgca
ccatggttttgcaaccagggtgccgcgcgacctcggaactttgttcccctcccgggacca
ccgtgcccgggattcgcgcggacacgccccgtccgaaaaatgccagaattccaaaataca
cttgtcattatgaagtcaattcgtagcctttcgacatctgctcccctccgcaactatgcg
tcgaccataaagaaccttaaggtcaacctggacaccaaggtgatttaccaaggtttcact
ggacgtcagggaactttccatgccgagcaagcgattgcctatggaaccaaaattgttgga
ggaaccaaccccaagaaggctggatccactcacttggacagacccgtgtttgccaatgtg
agcgacgccattaaggaaaccggcgccaacgccactgctatttttgtgccgccatcaatt
gcagccgccgcgattgaggaggccatcgaggccgaaattgaattggctgttgccattacc
gagggtattccgcagcacgacatggttcgtattgcgcagatgcttaagacgcaatcgaaa
acgcggttggtgggacccaattgcccgggattgattgcgcccgaccagtgtaagattggt
attatgccatcgcacattcaccagcggggtaaagttggagttatttcaagatctggtact
ttgacttacgaggctgtggcccagacaactggagtcggattgggtcaatcattggtgatt
ggaatgggaggagatccattcccaggtaccaatttcattgatgcattgacacttttcttg
gaagacaaggaaaccgagggtattattttgattggagaaatcggtggaactgccgaggaa
gaagccagtgaatttttgaaacagcacaacttgaccagaccagatggaccaaagccagtt
gtttcgtttattgctggtgttagtgctcctccaggtagaagaatgggacatgctggtgcc
attatttctggtggaaagggtgatgccaagtccaagattgccgctttggagagcgctgga
gttgttgtggaaagatcgccagccagattgggtaattctttgttggaggagttcaagaac
aagggtttgttgtag

DBGET integrated database retrieval system