KEGG   Meyerozyma guilliermondii: PGUG_03353Help
Entry
PGUG_03353        CDS       T01150                                 

Definition
(RefSeq) hypothetical protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pgu  Meyerozyma guilliermondii
Pathway
pgu00010  Glycolysis / Gluconeogenesis
pgu01100  Metabolic pathways
pgu01110  Biosynthesis of secondary metabolites
pgu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PGUG_03353
Enzymes [BR:pgu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     PGUG_03353
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 5126103
NCBI-ProteinID: XP_001483972
UniProt: A5DJA2
AA seq 300 aa AA seqDB search
MSVEETDTHVHLKHASGSTASILKYGATVISWKEDGIERLWLSEGAKTDGSKPVRGGIPL
VFPVFGKQTDEKHPTYPLPQHGFARNSTWEFLGQTTEDPTTVQFGLGPENVDPELYKLWA
NGSNDFTLILTVSLGSGLLRTEIEVENTGKQLFDFNWLFHTYYRIPDVTDTLVTNLVDSR
CNDKLLKEVYVEKAPMVSFHEEFDRVYEKIESHKVLQIVELGKVLVTIERENLQDAVVWN
PWIKKSEGMADFLPKNGYLNMLCIEPGHVSDFVNLAPGKKWKGAQKTTVGGEIKVQTNIY
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtagaagaaacagacacccatgtgcatctcaagcatgcttctggaagcactgct
tcgatcctcaagtacggcgctaccgtaatatcatggaaagaggacggaattgaacgttta
tggttgtcggagggtgccaaaaccgacggttccaagccggttcgtggaggtattccgctt
gtatttcctgtttttggcaagcaaaccgatgaaaaacaccctacttacccattgccacaa
cacgggtttgcccggaattctacatgggagtttttgggacaaacaactgaagatccaact
acggttcaatttggattaggaccggaaaacgttgatccggaactctacaagttgtgggcg
aatgggtccaatgacttcacgttgatcttgacggtttcgcttggttctgggctgctcagg
acggaaattgaagtggaaaataccggcaaacaactgttcgactttaactggttgttccac
acttattaccgtattcccgatgtcaccgacacattggtcaccaatttggtggattccagg
tgcaacgacaagcttttgaaggaggtttatgtggaaaaagcacctatggttagctttcat
gaagagtttgatcgagtgtacgagaagattgaatctcataaagttcttcaaattgtggaa
cttggaaaggttttggtcactatagaacgtgaaaacttgcaggacgctgtggtatggaat
ccatggatcaaaaagtcagaaggaatggcagatttcttgcctaagaatggttacttgaac
atgttgtgtattgagcccggtcatgtttcagactttgtcaatttggcacccggaaagaaa
tggaaaggagcgcaaaagaccactgttggaggagaaatcaaggtacagaccaatatatat
tag

DBGET integrated database retrieval system