KEGG   Meyerozyma guilliermondii: PGUG_03860Help
Entry
PGUG_03860        CDS       T01150                                 

Definition
(RefSeq) hypothetical protein
  KO
K07836  Ras-related protein Rap-1B
Organism
pgu  Meyerozyma guilliermondii
Brite
KEGG Orthology (KO) [BR:pgu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pgu04147]
    PGUG_03860
   04031 GTP-binding proteins [BR:pgu04031]
    PGUG_03860
Exosome [BR:pgu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PGUG_03860
  Exosomal proteins of other body fluids (saliva and urine)
   PGUG_03860
  Exosomal proteins of colorectal cancer cells
   PGUG_03860
GTP-binding proteins [BR:pgu04031]
 Small (monomeric) G-proteins
  Ras Family
   Rap [OT]
    PGUG_03860
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf G-alpha GTP_EFTU MMR_HSR1 NAD_binding_7 ParA
Motif
Other DBs
NCBI-GeneID: 5126232
NCBI-ProteinID: XP_001484479
UniProt: A5DKQ9
AA seq 258 aa AA seqDB search
MRSRKDRISMHEMSFPVVRSGATPLISGTNSDYKVVVLGAGGVGKSSVTVQFVQGVYVES
YDPTIEDSYRKQIEIDGRQCDLEILDTAGVAQFTAMRELYIKSGKGFLLVYSVTDENSLK
ELLALRDQVLRIKDLDSVPMVLIGNKCDLEEDRVLSIDDGLQVSQEWGMVPFYETSAMYK
TNVDEAFVDVVRQIMRKEAELSEEKKQQKLQKQAEAGPDAPAGAAEAEPASQTVAEKRRS
RQRLVATEGHKSKCCTIM
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaggtcacgcaaagaccggatatcaatgcatgaaatgtcatttccggtggtaagaagc
ggggctacacctttaatttcaggaactaactcagactataaagtggtggtacttggcgcc
ggtggtgtcggaaaatcgtcagtgactgtgcaatttgtgcagggcgtatacgttgaaagt
tacgatcccaccattgaggattcttatcggaaacaaatcgaaatcgacggaagacaatgt
gatttggagattttggacaccgcaggagtagcccagttcactgctatgcgtgagttgtat
attaaaagtggaaaaggcttcttgttggtatactctgtgaccgatgaaaattcgctcaag
gagttacttgcacttcgagatcaggtgttgagaatcaaggatctggactcggtgcccatg
gtgttgattggtaacaagtgtgacttggaagaggacagagtgttatcaattgatgatgga
cttcaagtatctcaagaatgggggatggttccattttatgagaccagtgctatgtacaag
accaacgttgacgaggcatttgtggacgttgtgcgccagataatgagaaaagaggccgaa
ttatcggaggaaaagaagcagcaaaagttgcaaaagcaggctgaggctggccccgatgcg
cctgcaggcgctgccgaggccgaaccggcttcgcagacggtggctgagaagagacgatcg
agacaacggctggtggccaccgagggccataagtcgaaatgttgcacgattatgtag

DBGET integrated database retrieval system