KEGG   Meyerozyma guilliermondii: PGUG_04211Help
Entry
PGUG_04211        CDS       T01150                                 

Definition
(RefSeq) hypothetical protein
  KO
K03146  cysteine-dependent adenosine diphosphate thiazole synthase [EC:2.4.2.60]
Organism
pgu  Meyerozyma guilliermondii
Pathway
pgu00730  Thiamine metabolism
pgu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    PGUG_04211
Enzymes [BR:pgu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.60  cysteine-dependent adenosine diphosphate thiazole synthase
     PGUG_04211
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thi4 DAO NAD_binding_8 FAD_binding_2 Pyr_redox_2 Lycopene_cycl NAD_binding_9 FAD_oxidored HI0933_like FAD_binding_3 GIDA Trp_halogenase Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 5125132
NCBI-ProteinID: XP_001483482
UniProt: A5DLR0
AA seq 332 aa AA seqDB search
MAPPTVLAPLLTLPLSGTFSARTPQQVTVDSEAANGDVKFADWDKFHFAPIRESAVSRAM
TKRYFADLDKYAESDVVIVGAGSAGLSAAYVLAKNRPELKIAIIEASVSPGGGCWLGGQL
FSAMVLRKPAHLFLDELNIAYEDEGNYVVVKHAALFMSTLMSKVLEFPNVKLFNATAVED
LITRRDETTGELRVSGVVTNWTLVALNHDTQLCMDPNTINASVLLSTTGHDGPFGAFCAK
RLESLSGDKHKLGGMRGLDMNLAEDAIVKGTREVAPGLVIAGMELAEVDGSNRMGPTFGA
MALSGVKAAEAVLNVFDERKKQNDDDAKKHGY
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggctccacctactgttcttgcaccactgctcactctcccactttcgggtacattttct
gcccgtacaccccaacaagttactgttgactccgaagctgcaaatggcgatgtgaagttt
gccgactgggacaaattccactttgcccccattcgtgaatcggcggtttccagggccatg
acaaaaagatatttcgctgatcttgataagtatgcggaatcagacgttgtgattgttgga
gcaggatcggctggtctctcggctgcttatgtgttagccaagaacagaccagagctcaag
attgccatcattgaagccagtgtgagtcccggaggaggatgctggcttggaggacaattg
ttctctgcgatggttttgagaaaacctgcccatcttttcttggacgaacttaacattgcc
tacgaagatgaaggcaattatgtcgtggtcaaacacgcagctttgttcatgtcgacgttg
atgtctaaagttcttgaattccccaacgtgaaacttttcaatgctactgcagtggaagat
cttatcactcgccgtgatgaaaccacaggtgaacttagggtgtcaggagttgtcaccaac
tggactttagttgctcttaaccacgacacccagctgtgtatggatcccaacaccatcaac
gctagtgtgttgttgagtactactggccatgatggtccctttggtgcattttgtgccaag
agattggaaagcttatcaggagacaaacataagcttggaggcatgcgtggtcttgacatg
aatctggccgaagatgccattgtcaagggcacccgagaggttgctcctggtttggttatt
gctggtatggagctcgccgaagtggatggatccaaccggatgggtccaacattcggagcc
atggcactctctggagtcaaggctgctgaggccgttttgaacgtttttgacgaacgcaag
aagcagaacgacgacgacgcaaagaaacacggatactag

DBGET integrated database retrieval system