KEGG   Meyerozyma guilliermondii: PGUG_04220Help
Entry
PGUG_04220        CDS       T01150                                 

Definition
(RefSeq) hypothetical protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pgu  Meyerozyma guilliermondii
Pathway
pgu00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PGUG_04220
Enzymes [BR:pgu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     PGUG_04220
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     PGUG_04220
    1.1.1.-  
     PGUG_04220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C Sacchrp_dh_NADP F420_oxidored
Motif
Other DBs
NCBI-GeneID: 5125541
NCBI-ProteinID: XP_001483491
UniProt: A5DLR9
AA seq 388 aa AA seqDB search
MVSHNSSMRAIVLHGVKDLKFHSDYPEPQLQSPTDVKIKVDYCGICGSDLHEYLDGPIFF
KNKRNEISNKENIQCMGHEMCGEIVELGAKVNPEYKVGQKVVVAPTGTCLDRPRFPDAPN
AKKQPCNACSEGSYNACDYIAFTGLGFEDGGFGDYCVVGDNHIVPYPPSVIPVDVAALIE
PLAVAWHAVRIAKLNEGELALVLGAGPIGLVMILALKAHKAGNIVVSEPAEARRKLAESF
GVQTFDPTNYESVDQSVTALKKLTNDGFGFHHSFDCSGIPVSFEVSLKALRTTGVATNVA
IWPEKPVDYFPMEITLHERTINGSMCHTREDFVNVVKAFEAKLVDIDQVRTLITGIVSVE
DGIEKGFNELINHKEKHIKILVSPRYAN
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggtttctcacaattcttcaatgagagcaattgttcttcatggtgttaaagatttaaaa
tttcacagcgattatccggagccgcagctacaatctccaacagatgtcaagataaaggtt
gattattgcggtatctgcggctctgatttgcacgaatatttggatgggccaattttcttt
aaaaacaaacgaaacgaaatctccaataaggaaaacatacaatgtatgggtcatgaaatg
tgtggagaaattgtggaattgggcgccaaggtgaacccagaatacaaagttggccagaaa
gtggtggtggcgccaaccggaacttgcttggatcgacctcggtttcctgatgcacccaac
gcaaagaagcagccctgcaatgcatgtagtgaaggatcatataatgcgtgcgactatatt
gcgtttaccggattgggattcgaagacggcggatttggcgactactgcgttgtgggcgac
aaccacattgtgccgtatccaccatcggtgattccggtggacgtggcggcattgattgag
ccgcttgcagttgcatggcatgcagtgcgcatcgctaagctaaatgagggcgaactggcg
ttggtgcttggcgcgggacccattggtctcgtgatgattcttgcgttaaaagcacacaag
gccggaaatattgtcgtgagtgagccggcagaagctcgcagaaagttggcagagtctttt
ggcgtgcagacttttgaccccacaaattacgaatcggtagaccagtcggttaccgcgctt
aaaaagttgaccaatgacggatttggcttccaccattctttcgactgttccggcattccg
gtctcgttcgaggtttctttgaaggcattacgaaccaccggagtagccaccaacgttgcc
atttggccggaaaaaccggtggattattttcccatggaaatcacattgcatgaaagaacc
atcaatggatccatgtgccatactcgtgaagactttgtaaacgttgtcaaggcattcgaa
gccaaacttgtagacattgaccaggtgagaactctaataaccggaattgtgtcggttgaa
gacggaatagaaaagggctttaacgagcttatcaaccacaaggagaaacacatcaagata
cttgtatcaccacgttatgctaattaa

DBGET integrated database retrieval system