KEGG   Meyerozyma guilliermondii: PGUG_04548
Entry
PGUG_04548        CDS       T01150                                 

Definition
(RefSeq) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
pgu  Meyerozyma guilliermondii
Pathway
pgu00100  Steroid biosynthesis
pgu01100  Metabolic pathways
pgu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pgu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    PGUG_04548
Enzymes [BR:pgu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     PGUG_04548
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 5125515
NCBI-ProteinID: XP_001483819
UniProt: A5DMP7
AA seq 443 aa
MTGSQLNPVTKHREFFGVPGALGMVLVLPMVIPLLYFVTNENYCIHGVSLDIEAIKKQIP
STWTQLLNICFHKQSWLFYLSWFSAITTLDLILPGKRMNGTQLRDGTYLTYNINGGAVSS
TVVAIIAARVVLAKNYYVPELQFVYDHHLHLIAVSIIFSFAMAIFVYAGSFVPLTHENGL
GTRERILSINGNSGNPIYDFFIGRELNPRIGAWDIKLFCELRPGLLLWIVIDLACIHHQY
HQYGVVTDSILLVSALQAIYVIDCSFYEEGSLTMLDITTDGFGFMLSFGDLAWLPWTYSL
QARFLSLPQNHVHLGWLNLMLIVALSGFGFYVYNASNNQKSEFRQGRLENMEYIKTKTGT
KLLCDGWWSKAQHINYLGDWLIAWAWCFTTGFRSPISYYYVVFVGGLLIHRQMRDDVKCS
AKYGEQWAEYKRRVPYKIIPYVY
NT seq 1332 nt   +upstreamnt  +downstreamnt
atgaccggaagtcaactcaatccagttacaaagcacagagaattctttggtgtgccgggg
gcattaggaatggtccttgtgttgccgatggtaataccattgctatatttcgttaccaac
gaaaattattgtattcacggagttagcttggacattgaagctataaagaaacaaattcca
agcacttggacacagcttctgaacatttgcttccacaagcaaagttggttattttatctt
tcgtggttctcagcaattacgactcttgatttgattttgccaggaaaaagaatgaatggt
actcaattgcgtgatggcacatatttgacctataacatcaacggaggagctgtttcgagt
acagttgtcgccataatagctgctagggttgtcctggcgaaaaactactatgttcccgag
ttgcagtttgtctatgatcatcatttgcatttgattgctgtgtcgattatcttttcgttt
gccatggcgatatttgtctacgctggctcatttgttcctctaactcacgagaacgggctt
ggaactcgagagcggatcttgtccattaatggcaattctggaaaccccatctacgatttt
ttcattgggcgagaactcaatcctcgaattggcgcttgggacatcaaattgttctgtgag
ttgcgcccaggattgcttctctggatcgtgatagaccttgcttgtatccaccaccaatac
caccaatatggagtggttacagattctatacttctcgtttcagccttgcaagccatctat
gtcattgactgctcgttctacgaagaagggtctctcaccatgctcgatattaccaccgat
ggttttggtttcatgctcagtttcggcgacttggcttggttgccatggacgtattcgctc
caggctcggttcttgtcgcttcctcaaaaccatgtccatttgggctggttgaatctgatg
ctaatagttgccttgagtggttttggtttctacgtttataatgcttccaacaaccaaaag
tcagaatttaggcagggaagattggagaacatggaatatatcaagaccaagactggaacc
aaattactctgcgacggttggtggtctaaggctcaacatatcaactaccttggtgactgg
ttgatagcatgggcttggtgctttacaacaggattcagatcgcctatctcatattactat
gtggtattcgtaggaggacttttgatccacaggcaaatgagagacgatgtcaaatgctcc
gccaagtacggtgaacaatgggcagagtataagcggagggtgccgtataagattattcct
tatgtgtattaa

DBGET integrated database retrieval system