KEGG   Meyerozyma guilliermondii: PGUG_04935Help
Entry
PGUG_04935        CDS       T01150                                 

Definition
(RefSeq) similar to heat shock protein hsp70Bb
  KO
K09490  heat shock 70kDa protein 5
Organism
pgu  Meyerozyma guilliermondii
Pathway
pgu03060  Protein export
pgu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pgu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    PGUG_04935
   04141 Protein processing in endoplasmic reticulum
    PGUG_04935
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pgu03110]
    PGUG_04935
   04131 Membrane trafficking [BR:pgu04131]
    PGUG_04935
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pgu04147]
    PGUG_04935
Chaperones and folding catalysts [BR:pgu03110]
 Heat shock proteins
  HSP70 / DNAK
   PGUG_04935
Membrane trafficking [BR:pgu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    PGUG_04935
Exosome [BR:pgu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PGUG_04935
  Exosomal proteins of other body fluids (saliva and urine)
   PGUG_04935
  Exosomal proteins of colorectal cancer cells
   PGUG_04935
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70
Motif
Other DBs
NCBI-GeneID: 5124721
NCBI-ProteinID: XP_001482980
UniProt: A5DNT4
AA seq 229 aa AA seqDB search
MGKSTKMWISGFTLFYVFLAVMLPLFSKNGGLVLADDSNDTENYGTVIGIDLGTTYSCVG
VMKGGKVEILANEQGNRITPSYVAFTDEERLIGDAAKNQASSNVENTVFDIKRLIGLKYD
DKIVQREIKHLPYKIEKKSGKPVVKVDYQGDQKTFSPEEVSGMILGKMKSIAEDYLGKKV
THAVVTVPAYFNDAQRQATKDAGTICRIECVENCQRTHRGCYCLRIGQD
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaatctaccaagatgtggatttcgggctttacgctcttctatgtgtttttggcg
gtcatgttgcctttgttctctaagaatggaggtttagtgcttgctgatgactcaaatgat
accgaaaattacggcaccgtcatcggcattgatttgggtaccacatactcgtgtgtggga
gttatgaagggaggcaaggttgagattcttgccaacgaacaaggtaacagaatcactcct
tcctatgttgctttcactgatgaagaacgtttaattggagatgctgcaaagaatcaagcc
tcttccaatgttgaaaacaccgtgtttgatatcaagagattgattggattaaagtatgat
gataagattgtccagcgtgaaatcaagcacttgccttacaaaattgagaagaagtctgga
aagccggtagtgaaggttgattatcaaggtgaccagaagaccttcagtcctgaagaagtt
tcgggaatgatcttaggtaagatgaaatctattgctgaagactacttgggtaaaaaggtt
acccatgcagttgtcactgttccagcttactttaacgatgctcagcgtcaagctaccaag
gatgccggtaccatttgccggattgaatgtgttgagaattgtcaacgaacccaccgcggc
tgctattgcttacggattggacaagactga

DBGET integrated database retrieval system