KEGG   Meyerozyma guilliermondii: PGUG_05477
Entry
PGUG_05477        CDS       T01150                                 
Name
(RefSeq) hypothetical protein
  KO
K14013  UBX domain-containing protein 2
Organism
pgu  Meyerozyma guilliermondii
Pathway
pgu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pgu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PGUG_05477
SSDB
Motif
Pfam: UBA_4 UBX AAA_23 ArsP_2
Other DBs
NCBI-GeneID: 5124461
NCBI-ProteinID: XP_001482457
UniProt: A5DQC6
AA seq 568 aa
MDLTPEQQDLVTQFVSISGAEDDRQKVVSLLTVNNWDLNNALSSYFDHGFDVIDRISLLA
NSGSQDAAVSASGPEILQDPAESHLSHRRTSSSAGPELVNLQSQMFLESFRPKLPKAPRI
SNHWQLELGIHSSLSEKLLHNPDRRPAVNSWWLVLLLVPRTLLLFLVSIFKFLFVGSSSH
FIGRFPSQFDYAKYSENFDFKESIDNKTSEVSPEVVDLSQFNIKSSDFNLVLQSAQTGYS
WLLVILVDNRSESQEFCRRLFSSPEFAQLLNKTSGTFKDNQIFVNNVEESPEAYEVGKTY
KAKRLPFLCLAANVSNDPSVMASMSTLYKSNVAPDFLSPELINSTIKKLTENLEKLMESY
DPQLIAQRFDQQEIEFARQLKKQQDDAYIQSLEKDRLKKMEKDHQQQMEKTMKEMAQKRE
TFLMSLIRENWFHGVCEGENKVKIAIKLPNGKRLIETVLKTVTLQQLYLYVETRLYEEDK
EINSENEKEISLDNEKEINSDPILHNEYFATFPFKFDLIQPYPKKVLDVTGETLGDIPEL
RSGANLLVEYQEVGDSDASDDASDDDHR
NT seq 1707 nt   +upstreamnt  +downstreamnt
atggatcttacacccgaacagcaagatcttgtgacacaatttgtgtctatatctggcgct
gaggacgatagacaaaaggtggtgtcgcttctaaccgtcaacaattgggatttaaacaat
gctctttcgtcgtatttcgaccatggatttgacgtaattgaccggatatcactgctggca
aattccggaagtcaagatgcagcagtatctgcatcgggtccggaaatactccaggaccct
gcagaatcgcatctctctcatcgacgaacctcatcttcggcaggacccgaattagtcaat
cttcagagccaaatgtttctcgagtcgtttcgaccaaaacttcccaaggcgccacgaatt
tccaatcattggcaactagagctcggaatccactcatcgctttcggaaaaactgctgcat
aatcctgaccgtcggccggccgtcaattcatggtggttagtgctcttgctcgtgccaaga
actcttcttctgtttttggtttcgatcttcaagtttctctttgtgggctcgagtagtcat
tttatcggccggtttccatcgcaattcgattatgcaaagtattctgagaattttgatttc
aaagaatcgattgacaacaaaacttcggaagtttctccagaagtggtggacttgtcgcaa
ttcaacataaaaagctccgatttcaatctggtgctccaatctgcgcaaaccgggtactca
tggcttcttgttattctagtagataatcgcagcgaatcgcaagaattttgtcggcggctt
ttttccagtccagaatttgcccaattgctcaacaagacaagtggaacctttaaagacaac
cagatttttgttaataatgttgaagagtcgccagaagcttacgaagtgggaaagacatac
aaagctaaaagacttccatttttgtgtcttgcagccaatgtttccaatgatccctcggta
atggcatcgatgtctacactctacaagtccaatgtggcaccagactttctttctccagaa
ctgataaattccaccattaaaaaattgactgaaaatttggagaagttgatggagtcttat
gatcctcaattaattgcccaaagatttgaccagcaagaaattgagtttgcaaggcagctt
aaaaagcagcaggacgatgcatatatccagtcccttgaaaaagaccggttgaaaaaaatg
gaaaaagatcaccagcagcaaatggagaaaaccatgaaagaaatggcccaaaaacgggaa
acatttttgatgagtttgattcgagaaaactggttccacggtgtttgcgagggcgaaaac
aaggtaaaaattgctataaaactccccaatggtaaacggctcatcgaaacggttctgaaa
accgtcactttgcagcaattgtacttgtatgtggaaacgagattgtatgaggaggataaa
gagattaattcggaaaacgaaaaagagattagtttggataacgaaaaagagattaattcg
gatccaattctgcataacgagtattttgctacatttccattcaagttcgacctcattcag
ccgtaccccaaaaaagttttggatgtgaccggcgagaccctcggcgacattccggaattg
cgctcgggcgccaatttgctcgtagagtaccaggaagttggtgacagcgacgccagcgac
gacgccagcgacgacgaccatagataa

DBGET integrated database retrieval system