KEGG   Meyerozyma guilliermondii: PGUG_05628Help
Entry
PGUG_05628        CDS       T01150                                 

Definition
(RefSeq) argininosuccinate lyase
  KO
K01755  argininosuccinate lyase [EC:4.3.2.1]
Organism
pgu  Meyerozyma guilliermondii
Pathway
pgu00220  Arginine biosynthesis
pgu00250  Alanine, aspartate and glutamate metabolism
pgu01100  Metabolic pathways
pgu01110  Biosynthesis of secondary metabolites
pgu01130  Biosynthesis of antibiotics
pgu01230  Biosynthesis of amino acids
Module
pgu_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:pgu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PGUG_05628
   00220 Arginine biosynthesis
    PGUG_05628
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pgu04147]
    PGUG_05628
Enzymes [BR:pgu01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.1  argininosuccinate lyase
     PGUG_05628
Exosome [BR:pgu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PGUG_05628
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lyase_1 ASL_C2
Motif
Other DBs
NCBI-GeneID: 5124421
NCBI-ProteinID: XP_001482608
UniProt: A5DQS7
AA seq 464 aa AA seqDB search
MSDTPAKLWGGRFTGATDPLMDLYNASLPYDKKMYAADLHGTAVYTQGLQKLGILSADEL
SSIQEGLKVVEKEWELGKFVEKPGDEDIHTANERRLGEVIGKHIAGKVHTGRSRNDQVAT
DMRIFVRETLTTLLEYLSQLIGTIVNRAGQEIDVLMPGYTHLQRAQPIRWAHWLSSYATY
FTEDYKRLKELLVRVNQSPLGSGALAGHPYGIDREFLAENLGFDGVIGNSLVAVSDRDFV
VESLFWCSLFMNHISRFSEDLIIYSAAEFGFVKLADAYSTGSSLMPQKKNPDSLELLRGK
CGRVFGSLAGFMMSIKSIPSTYNKDMQEDKEPLFDALTTVEHSILIATGVISSLSINKEK
MEAALTMDMLATDLADYLVMKGVPFRETHHISGECVSRAEELKLSGIDKLTMEQLQAIDS
RFGEDVKDVFNFEASVERRNATGGTAKSAVLKQLELLKKQVKGN
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatacaccagccaagctctggggtggccgttttaccggtgctaccgaccccttg
atggacttgtacaatgcttctcttccatacgataaaaaaatgtacgcggcagatttacat
ggaactgccgtttatacgcaagggttgcagaaattgggcattctttccgccgacgaattg
tcgtcgatccaagaaggattgaaggttgttgagaaagagtgggaactggggaagtttgtg
gagaagcctggtgacgaggatatccacaccgctaacgagagaaggttgggagaggtgatt
ggaaaacacattgctggaaaagtgcacacgggccgttctcggaatgaccaagttgcaacc
gatatgcggatttttgttcgtgagacgttgaccacgctcttggaatacttgtcgcagctc
attggcaccatagtcaaccgagcaggtcaagaaattgacgttttgatgcctggctacacc
cacttacaaagagctcagcctatcagatgggctcattggttgtcgtcctatgccacctac
tttactgaagactacaagagactcaaggagcttttggttagagtcaaccagtcacctttg
ggcagtggagcgttggctggacatccgtacggaattgaccgagaattcttggcggaaaat
ttgggctttgacggagtcattggtaactcgcttgtagctgtcagtgaccgtgattttgtg
gtggagtcgctcttctggtgctcactattcatgaaccatatctcgagattttctgaggat
ttgatcatctactcggctgccgagtttggttttgtcaagttggccgacgcatattccact
ggatcatctttgatgccccagaagaagaacccggactcgttggagttgttgagaggaaaa
tgtggccgtgtctttggctcgcttgctgggtttatgatgtccattaagtcaattccttcc
acttacaacaaggacatgcaagaagacaaagagccattatttgatgccttgactacagtc
gaacactcgatcttaattgctactggagttatctcgtcattgtctattaacaaagagaaa
atggaggctgctttaaccatggatatgttggctactgacttggctgattacttggtgatg
aagggtgttcctttcagagaaacccaccatatttctggagagtgtgttagtcgggctgag
gaattgaaactctccggcattgacaagttgactatggaacaacttcaggctatcgactcc
agatttggagaagatgtaaaggacgttttcaactttgaagctagtgtcgaaagaagaaat
gccactggaggcactgccaagtctgctgtgttgaagcagttggaactgttgaagaagcag
gtcaaaggaaattaa

DBGET integrated database retrieval system