KEGG   Meyerozyma guilliermondii: PGUG_05681Help
Entry
PGUG_05681        CDS       T01150                                 

Definition
(RefSeq) hypothetical protein
  KO
K01469  5-oxoprolinase (ATP-hydrolysing) [EC:3.5.2.9]
Organism
pgu  Meyerozyma guilliermondii
Pathway
pgu00480  Glutathione metabolism
pgu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PGUG_05681
Enzymes [BR:pgu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.9  5-oxoprolinase (ATP-hydrolysing)
     PGUG_05681
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydantoinase_B SH3_2
Motif
Other DBs
NCBI-GeneID: 5123848
NCBI-ProteinID: XP_001481918
UniProt: A5DQY0
AA seq 320 aa AA seqDB search
MDDGAKIQLTIDINEEDGSAVFDFEGTADETFNCFNAPRAVTYACITYCLRCHITEGDLP
MNEGVLAPIEVRIPEGTVLNPSVTAAVSGGNGITSQKITDTILKAFGTVAASYGCMNCLC
FGQGGLDKKTGEMVAGFGFCETIGGGSGAGNGFNGFSGTQCHMTNTLMTDPEVLELRYPV
LLKQFSIRKNSGGAGKWHGGDGLVRELEFTSPCHASILTQRRVVPPYGMAGGGEGARGEN
KLGRVDGNGKIHWKHVGPTAEIELNVGDIIKILTPGGGGYGRAGEHSEPGSEQNGGNLRV
GSLRAGGSLGLMREAMNSSQ
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggatgatggagccaaaatccaacttaccatcgatatcaatgaagaggatggttcggcg
gtgtttgatttcgaaggtaccgcagacgaaactttcaactgtttcaatgcccctcgagca
gttacttatgcctgtatcacctactgcttaagatgccatattaccgaaggtgacttgccc
atgaacgaaggagtgctagctccaatagaggtacgcattcccgaaggcacagtattgaac
cccagtgtcaccgctgctgtttctggaggaaatggtattacttctcaaaaaattaccgac
acaattttaaaagcttttggtactgttgctgcatcttatgggtgtatgaattgcttgtgt
tttggccaaggaggtcttgataaaaaaacaggagaaatggttgctgggtttgggttctgt
gagacaatcggcggaggttcaggtgctggaaatgggttcaatggtttcagtggaacccaa
tgccatatgacgaatacgcttatgacagaccctgaagttcttgagctgcggtatcctgtt
cttttgaagcaattttcaattcgaaaaaatagtgggggtgctggaaaatggcatggaggt
gatggtttggtcagagaattggaattcacttcgccgtgccatgcttcaatattaacccag
agaagagtagttccaccatatggaatggcaggaggaggcgaaggtgctagaggagagaac
aagttgggacgagttgacgggaatgggaaaattcactggaaacatgtgggtcctacggca
gaaatagagttgaatgtgggagacattatcaagattttgacacccggcggaggcggatat
ggacgtgctggcgagcatagcgagccaggaagcgaacaaaacggaggaaatttgagagtg
ggaagtttgagagcaggaggcagtttgggactcatgagagaagccatgaacagttcgcag
taa

DBGET integrated database retrieval system